Homologs in group_350

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14720 FBDBKF_14720 92.3 Morganella morganii S1 fabD ACP S-malonyltransferase
EHELCC_15525 EHELCC_15525 92.3 Morganella morganii S2 fabD ACP S-malonyltransferase
NLDBIP_16055 NLDBIP_16055 92.3 Morganella morganii S4 fabD ACP S-malonyltransferase
LHKJJB_15785 LHKJJB_15785 92.3 Morganella morganii S3 fabD ACP S-malonyltransferase
HKOGLL_14905 HKOGLL_14905 92.3 Morganella morganii S5 fabD ACP S-malonyltransferase
PMI_RS04220 PMI_RS04220 77.7 Proteus mirabilis HI4320 fabD ACP S-malonyltransferase
PMI_RS14345 PMI_RS14345 29.7 Proteus mirabilis HI4320 - ACP S-malonyltransferase

Distribution of the homologs in the orthogroup group_350

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_350

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O85140 1.2e-160 452 74 0 307 1 fabD Malonyl CoA-acyl carrier protein transacylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AAI9 2.43e-160 452 74 0 308 1 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli (strain K12)
P0AAJ0 2.43e-160 452 74 0 308 3 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X8I7 7.42e-160 451 73 0 308 3 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli O157:H7
P43712 7.22e-153 433 72 1 309 3 fabD Malonyl CoA-acyl carrier protein transacylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P71019 4.25e-82 253 44 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Bacillus subtilis (strain 168)
Q8K9J6 1.72e-80 249 41 2 288 3 fabD Malonyl CoA-acyl carrier protein transacylase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AH0 3.58e-71 225 34 2 309 3 fabD Malonyl CoA-acyl carrier protein transacylase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q6GHK5 2.32e-68 218 36 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MRSA252)
Q7A124 3.01e-68 218 36 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MW2)
Q7A5Z3 3.01e-68 218 36 2 310 1 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain N315)
Q99UN8 3.01e-68 218 36 2 310 1 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q93QD4 4.54e-68 217 36 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus
Q6G9Y3 4.54e-68 217 36 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MSSA476)
Q5HGK3 4.54e-68 217 36 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain COL)
Q9R9J2 1.11e-58 196 35 2 304 1 fenF Malonyl CoA-acyl carrier protein transacylase Bacillus subtilis
O34825 3.93e-48 165 36 5 285 1 pksC Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC Bacillus subtilis (strain 168)
Q2T4N0 1.47e-47 174 36 4 289 3 thaF Polyketide biosynthesis protein ThaF Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A7Z4Y0 2.33e-46 169 34 6 286 1 baeE Polyketide biosynthesis protein BaeE Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A7Z4X8 2.34e-46 161 35 6 285 1 baeC Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P73242 8.97e-45 157 35 7 303 1 fabD Malonyl CoA-acyl carrier protein transacylase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O34787 4.49e-40 152 34 5 283 1 pksE Polyketide biosynthesis protein PksE Bacillus subtilis (strain 168)
Q8T3L6 3.26e-37 139 33 6 311 2 beg Probable malonyl-CoA-acyl carrier protein transacylase, mitochondrial Drosophila melanogaster
Q8IVS2 6.4e-37 139 33 6 299 1 MCAT Malonyl-CoA-acyl carrier protein transacylase, mitochondrial Homo sapiens
Q8R3F5 8.51e-36 135 32 6 299 1 Mcat Malonyl-CoA-acyl carrier protein transacylase, mitochondrial Mus musculus
E9F8M3 6.35e-33 132 33 9 290 1 swnK PKS-NRPS hybrid synthetase swnK Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
I6XD69 3.01e-28 118 34 8 305 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I6XD69 3.86e-13 73 29 10 287 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
D4AU31 4.32e-28 117 27 6 311 3 swnK PKS-NRPS hybrid synthetase swnK Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
A0A2I2F262 1.12e-26 114 29 8 294 1 acdB PKS-NRPS hybrid synthetase acdB Aspergillus candidus
Q7TXL6 4.55e-25 108 30 9 299 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQE1 4.9e-25 108 30 9 299 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE0 4.9e-25 108 30 9 299 3 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
G3XNF4 2.01e-24 107 31 10 292 1 ATPKS PKS-NRPS hybrid synthetase ATPKS Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
P96285 4.23e-24 106 32 5 282 1 pks1 Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TXK8 5.25e-24 105 32 5 282 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WNG5 1.33e-23 101 31 5 304 1 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNG4 1.33e-23 101 31 5 304 3 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63459 1.33e-23 101 31 5 304 3 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A1B3PEI6 9.44e-23 102 27 7 310 1 ORF-A Polyunsaturated fatty acid synthase subunit A Thraustochytrium sp. (strain ATCC 26185 / S-3)
B2HIL7 4.48e-22 100 32 8 285 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium marinum (strain ATCC BAA-535 / M)
Q9ZGI5 4.71e-21 97 33 7 290 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 4.57e-13 73 31 8 234 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 6.6e-13 73 30 7 234 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
A0A455M7S4 1.26e-20 95 27 7 291 1 atnG Non-reducing polyketide synthase atnG Arthrinium sp.
A0A455LXK0 1.27e-20 95 27 9 313 2 ntnG Non-reducing polyketide synthase ntnG Nectria sp.
Q03131 2.48e-20 95 30 12 301 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 1.54e-12 72 27 8 296 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 3.19e-05 49 26 8 294 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
P9WQE3 4.69e-20 94 33 13 287 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit D Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE2 4.69e-20 94 33 13 287 3 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TXL7 5.24e-20 94 33 13 287 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O13698 6.13e-19 88 28 12 310 3 mct1 Malonyl CoA-acyl carrier protein transacylase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0R0B2 2.81e-18 86 32 10 253 1 fabD Malonyl CoA-acyl carrier protein transacylase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P0CU67 3.93e-18 88 27 10 308 1 claG Atrochrysone carboxylic acid synthase Passalora fulva
Q07017 8.93e-18 87 32 9 298 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
Q07017 2.08e-16 83 30 6 295 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
A0A6F9DYX9 1.43e-17 87 29 11 300 1 men2 Non-reducing polyketide synthase men2 Menisporopsis theobromae
Q03149 4.44e-17 85 29 13 319 1 wA Conidial yellow pigment biosynthesis polyketide synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
E4V2N2 1.09e-16 84 29 13 314 3 nscA Non-reducing polyketide synthase nscA Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)
A7Z4X9 1.63e-16 82 26 11 293 1 baeD Polyketide biosynthesis acyltransferase homolog BaeD Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B3FWS8 2.06e-16 83 29 10 296 1 hpm3 Non-reducing polyketide synthase hmp3 Hypomyces subiculosus
A0A0S6XH49 2.97e-16 83 28 9 305 1 frbB Highly reducing polyketide synthase frbB Fungal sp. (strain No.11243)
L7XAV2 3.25e-16 82 28 12 318 1 curS2 Non-reducing polyketide synthase curS2 Aspergillus terreus
Q9ZGI3 3.49e-16 82 28 7 283 1 pikAIII Narbonolide/10-deoxymethynolide synthase PikA3, module 5 Streptomyces venezuelae
D4AWH3 4.02e-16 82 28 13 328 3 nscA Non-reducing polyketide synthase nscA Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Q0CCY3 6.08e-16 82 25 9 310 1 gedC Atrochrysone carboxylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P9WEV0 6.76e-16 82 28 12 319 3 valA Highly reducing polyketide synthase valA Aspergillus terreus
W3X8X8 7.82e-16 81 27 9 286 1 fnsA Naringenin synthase Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q12397 1.27e-15 81 26 10 304 2 stcA Norsolorinic acid synthase stcA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
F2T0M0 1.35e-15 80 26 10 306 3 nscA Non-reducing polyketide synthase nscA Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
B8MV60 1.42e-15 80 27 12 301 3 tpeB Non-reducing polyketide synthase tpeB Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
P9WET4 1.47e-15 80 27 11 316 1 Preu5 Highly reducing polyketide synthase Preu5 Preussia isomera
Q5BA83 1.58e-15 80 25 8 322 3 easB Highly reducing polyketide synthase easB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
M1WG96 1.99e-15 80 25 10 302 2 CPUR_05437 Non-reducing polyketide synthase CPUR_05437 Claviceps purpurea (strain 20.1)
G3XMC4 5.32e-15 79 25 11 313 1 azaA Non-reducing polyketide synthase azaA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
F2S6Z9 6.27e-15 79 26 10 306 3 nscA Non-reducing polyketide synthase nscA Trichophyton tonsurans (strain CBS 112818)
Q9ZGI2 7.2e-15 79 29 8 234 1 pikAIV Narbonolide/10-deoxymethynolide synthase PikA4, module 6 Streptomyces venezuelae
A0A1L9WLD9 7.26e-15 79 29 7 235 1 AacuL Atrochrysone carboxylic acid synthase AacuL Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
O34877 7.77e-15 77 23 8 291 1 pksD Polyketide biosynthesis acyltransferase homolog PksD Bacillus subtilis (strain 168)
P9WET9 8.29e-15 78 28 9 277 1 PvBS090_009107 Non-reducing polyketide synthase PvBS090_009107 Byssochlamys spectabilis
A0A0A2KT65 1.05e-14 78 26 10 306 2 melA Conidial yellow pigment biosynthesis polyketide synthase melA Penicillium expansum
A0A4P8DJU2 1.07e-14 78 25 8 298 3 dmx-nrPKS Atrochrysone carboxylic acid synthase Cryptosporiopsis sp. (strain 8999)
A2QTE9 1.57e-14 77 24 10 311 3 epaA Non-reducing polyketide synthase epaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
B0G0Z9 1.61e-14 77 24 11 319 3 pks6 Probable polyketide synthase 6 Dictyostelium discoideum
J4UHQ6 1.91e-14 77 31 11 257 1 OpS1 Orsellinic acid synthase Beauveria bassiana (strain ARSEF 2860)
I1RVD8 1.93e-14 77 25 7 311 3 PKS6 Highly reducing polyketide synthase PKS6 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q5BEJ6 2.02e-14 77 26 7 278 1 afoE Iterative polyketide synthase afoE Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B0G101 2.12e-14 77 24 11 319 3 pks8 Probable polyketide synthase 8/35 Dictyostelium discoideum
Q4WQZ5 2.71e-14 77 27 7 269 2 tpcC Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
W3X7U2 2.9e-14 77 27 6 233 2 PfmaE Conidial pigment polyketide synthase PfmaE Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
B8MYS6 3.05e-14 77 27 11 287 1 pks27 Non-reducing polyketide synthase pks27 Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
Q3S2U6 3.27e-14 77 28 14 326 1 mokB Lovastatin diketide synthase mokB Monascus pilosus
A0A067XNI2 4.17e-14 76 26 11 305 2 ptaA Non-reducing polyketide synthase ptaA Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q03133 4.19e-14 76 29 10 284 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q03133 4.13e-09 61 27 10 293 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
D4CZZ2 4.81e-14 76 25 9 304 3 nscA Non-reducing polyketide synthase nscA Trichophyton verrucosum (strain HKI 0517)
Q0D1N9 5.46e-14 76 26 7 294 1 terA Non-reducing polyketide synthase terA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
I3ZNU9 5.75e-14 76 26 4 234 1 armB Orsellinic acid synthase armB Armillaria mellea
A1D8I9 5.77e-14 76 26 9 300 3 nscA Non-reducing polyketide synthase nscA Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
C5H882 7.22e-14 75 26 9 310 3 radS2 Non-reducing polyketide synthase rads2 Floropilus chiversii
A0A098D6U0 7.24e-14 75 27 9 289 1 ZEA1 Non-reducing polyketide synthase ZEA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A1W5T1T1 7.75e-14 75 29 12 316 2 poxF Highly reducing polyketide synthase poxF Penicillium oxalicum
E5A7D9 8.2e-14 75 26 11 308 2 pks5 Highly reducing polyketide synthase pks5 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
A0A6H0YV38 8.9e-14 75 26 10 296 2 crz7 Non-reducing polyketide synthase crz7 Cladonia metacorallifera
A0A1P8NTI3 1.44e-13 75 27 10 299 2 pks8 Non-reducing polyketide synthase 8 Pestalotiopsis microspora
A0A2I2F2N6 1.45e-13 75 29 10 288 1 cfoA Chalcone synthase cfoA Aspergillus candidus
A0A3G9GQ29 1.97e-13 74 26 10 301 1 cdmE 6-hydroxymellein synthase cdmE Talaromyces verruculosus
P9WES9 2e-13 74 24 8 277 1 PFUR17_0229 Non-reducing polyketide synthase PFUR17_0229 Pseudevernia furfuracea
P9WET1 2.11e-13 74 26 12 313 1 Preu7 Non-reducing polyketide synthase Preu7 Preussia isomera
G0R6S8 2.19e-13 74 26 10 310 2 sor1 Highly reducing polyketide synthase sor1 Hypocrea jecorina (strain QM6a)
A0A284RE13 2.22e-13 74 26 5 238 1 armB Orsellinic acid synthase ArmB Armillaria ostoyae
Q9ZGI4 2.61e-13 74 29 9 238 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q9ZGI4 3.73e-11 67 27 7 234 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q54B49 3.3e-13 73 26 8 237 3 pks45 Probable polyketide synthase 45 Dictyostelium discoideum
A0A4P8GHJ1 3.55e-13 73 24 11 302 1 eupA 3-methylorcinaldehyde synthase Phoma sp.
Q5BH30 3.7e-13 73 26 9 292 3 mdpG Atrochrysone carboxylic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q86AE3 3.81e-13 73 24 11 319 2 pks9 Probable polyketide synthase 9/36 Dictyostelium discoideum
M3A326 4.11e-13 73 26 10 307 2 PKS8-1 Non-reducing polyketide synthase PKS8-1 Pseudocercospora fijiensis (strain CIRAD86)
A0A348HAX6 4.83e-13 73 25 12 317 1 phiA Highly reducing polyketide synthase phiA Fungal sp. (strain ATCC 74256)
A0A084B9Z6 5.15e-13 73 26 13 320 3 SAT8 Non-reducing polyketide synthase SAT8 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
Q4WA61 7.08e-13 72 27 7 268 3 nscA Non-reducing polyketide synthase nscA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q5B8A0 8.02e-13 72 27 6 242 1 pkfA Non-reducing polyketide synthase pkfA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q03132 8.97e-13 72 26 7 284 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
Q03132 8.89e-12 69 28 11 285 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
A0A3G1DJH7 9.01e-13 72 27 14 312 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
A0A2H3CTK0 1.14e-12 72 27 5 238 1 armB Orsellinic acid synthase armB Armillaria gallica
A0A084API3 1.21e-12 72 27 14 320 3 SAT13 Highly reducing polyketide synthase SAT13 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
A0A1W7M1U5 1.31e-12 72 25 9 295 1 pgmA Non-reducing polyketide synthase pgmA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A0N7D745 1.33e-12 72 24 10 316 2 Dhc5 Non-reducing polyketide synthase Dhc5 Alternaria cinerariae
A7UMW1 1.41e-12 72 26 8 296 2 PKS1 Non-reducing polyketide synthase 1 Elsinoe fawcettii
A0A481WQB6 1.46e-12 72 25 9 294 1 claF Clavatol synthase claF Penicillium crustosum
Q5AUX1 1.47e-12 72 25 7 311 1 orsA Orsellinic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P9WQE5 1.57e-12 71 28 8 260 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE4 1.57e-12 71 28 8 260 3 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TXL9 1.61e-12 71 28 8 260 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B0G100 2.28e-12 71 25 11 319 3 pks7 Probable polyketide synthase 7 Dictyostelium discoideum
I1RF58 2.52e-12 71 26 7 251 1 PKS12 Non-reducing polyketide synthase PKS12 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A0B4FTU6 2.58e-12 71 28 8 234 1 Pks1 Polyketide synthase 1 Metarhizium anisopliae (strain ARSEF 549)
A0A2I1C3X5 2.62e-12 71 26 9 300 1 nsrB Atrochrysone carboxylic acid synthase nsrB Aspergillus novofumigatus (strain IBT 16806)
B6HNK3 2.72e-12 71 26 13 314 3 sorA Highly reducing polyketide synthase sorA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A5C1RD96 2.94e-12 70 24 8 294 3 pksAC Non-reducing polyketide synthase AC Didymella fabae
Q86ZD9 3.43e-12 70 26 13 314 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain C2932)
E9KMQ2 3.88e-12 70 25 10 296 2 PKS16 Non-reducing polyketide synthase PKS16 Cladonia grayi
S0DTP6 5.3e-12 70 25 10 298 2 FSR1 Non-reducing polyketide synthase fsr1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q4W944 5.49e-12 70 25 9 291 1 encA Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q5AUX7 5.51e-12 70 26 11 309 1 dbaI Non-reducing polyketide synthase dbaI Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0B4G9F9 5.66e-12 70 28 7 234 1 Pks1 Polyketide synthase 1 Metarhizium guizhouense (strain ARSEF 977)
Q5AXA9 5.79e-12 70 30 4 206 1 pkgA Non-reducing polyketide synthase pkgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B8M9J9 5.83e-12 70 23 6 250 1 tropA 3-methylorcinaldehyde synthase tropA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q5B0D0 5.97e-12 70 23 8 297 1 aptA Non-reducing polyketide synthase aptA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
M2XHZ5 6.16e-12 70 28 6 235 2 pksA Norsolorinic acid synthase Dothistroma septosporum (strain NZE10 / CBS 128990)
Q30DW5 6.16e-12 70 28 6 235 2 pksA Norsolorinic acid synthase Dothistroma septosporum
Q5BBP8 6.23e-12 70 26 11 298 1 pkhA Non-reducing polyketide synthase pkhA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C8VJR7 6.29e-12 70 27 14 327 1 alnA Highly reducing polyketide synthase alnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54FD2 6.41e-12 70 24 14 322 3 pks38 Probable polyketide synthase 38 Dictyostelium discoideum
A0A2U8NET4 6.74e-12 70 25 7 235 1 Pks1 Polyketide synthase 1 Metarhizium album (strain ARSEF 1941)
P0CU84 6.83e-12 70 27 12 312 1 apmlA Highly reducing polyketide synthase apmlA Arthrinium phaeospermum
Q0CF75 7.87e-12 69 25 14 354 1 ATEG_07659 Highly reducing polyketide synthase ATEG_07659 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
G3XMD1 8.07e-12 69 26 12 314 1 azaB Highly reducing polyketide synthase azaB Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
R4WH05 8.13e-12 69 28 16 339 3 ACRTS2 Highly reducing polyketide synthase ACRTS2 Alternaria alternata
P9WQE7 8.26e-12 69 27 7 260 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5PHD6 8.73e-12 69 28 7 210 1 aspks1 3-methylorcinaldehyde synthase Sarocladium schorii
A0A3G9K3K9 9.09e-12 69 32 6 189 1 hisps Hispidin synthase Neonothopanus nambi
I1RLA7 1.23e-11 69 25 11 312 2 FGR1 Highly reducing polyketide synthase 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A443HK81 1.25e-11 68 23 10 326 1 VdtA Non-reducing polyketide synthase VdtA Byssochlamys spectabilis
C5FM57 1.46e-11 68 26 10 300 3 nscA Non-reducing polyketide synthase nscA Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
A0A1B5L6A0 1.74e-11 68 25 12 309 1 UVI_02036160 Non-reducing polyketide synthase ustP Ustilaginoidea virens
Q2UB00 1.74e-11 68 26 13 317 3 ppsB Reducing polyketide synthase ppsB Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q0CF73 1.75e-11 68 26 11 300 1 ATEG_07661 Non-reducing polyketide synthase ATEG_07661 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
E9F646 1.8e-11 68 28 8 234 1 Pks1 Polyketide synthase 1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A0K0MCJ4 1.86e-11 68 27 11 295 1 cazM Iterative polyketide synthase CazM Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
W7LKX1 1.89e-11 68 29 12 308 2 FUM1 Highly reducing polyketide synthase FUM1 Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A0B4H4F0 1.92e-11 68 28 8 234 1 Pks1 Polyketide synthase 1 Metarhizium majus (strain ARSEF 297)
A0A0N0DCA3 1.92e-11 68 26 15 329 2 DEP5 Reducing polyketide synthase DEP5 Fusarium langsethiae
A0A0B4I1L1 2.51e-11 68 28 12 290 2 Pks2 Polyketide synthase 2 Metarhizium guizhouense (strain ARSEF 977)
Q54FC8 2.96e-11 68 24 8 268 3 pks39 Probable polyketide synthase 39 Dictyostelium discoideum
Q0UI00 3.08e-11 67 25 11 327 1 elcA Non-reducing polyketide synthase elcA (Fragment) Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
F2PWS5 3.9e-11 67 25 9 302 3 nscA Non-reducing polyketide synthase nscA Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
B6QK76 3.98e-11 67 23 9 298 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN5 3.98e-11 67 23 9 298 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei
P9WES2 4.2e-11 67 28 5 223 1 None Atrochrysone carboxylic acid synthase PKS4 Calonarius odorifer
P9WQE6 4.42e-11 67 27 7 260 3 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q4WZA8 4.53e-11 67 26 7 250 1 alb1 Conidial pigment polyketide synthase alb1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q5AZ32 4.68e-11 67 25 9 291 1 pkbA Non-reducing polyketide synthase pkbA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0B4ESU9 4.78e-11 67 28 8 234 1 Pks1 Polyketide synthase 1 Metarhizium brunneum (strain ARSEF 3297)
A0A2U8NEV6 5.05e-11 67 26 8 238 1 Pks1 Polyketide synthase 1 Metarhizium acridum (strain CQMa 102)
Q0CSA2 5.32e-11 67 25 6 227 1 tazA Non-reducing polyketide synthase tazA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
D7PHZ2 5.38e-11 67 23 10 299 1 vrtA Non-reducing polyketide synthase vrtA Penicillium aethiopicum
F9XMW3 5.79e-11 67 26 9 302 3 PKS1 Non-reducing polyketide synthase PKS1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
B6HN77 5.85e-11 67 26 11 271 3 sorB Non-reducing polyketide synthase sorB Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
Q54B51 6.84e-11 67 25 7 235 3 pks44 Probable polyketide synthase 44 Dictyostelium discoideum
A5ABG0 6.87e-11 67 27 15 334 1 pynA Hybrid PKS-NRPS synthetase pynA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q54T36 7.3e-11 66 23 9 315 3 pks19 Probable polyketide synthase 19 Dictyostelium discoideum
B0G138 7.57e-11 66 23 9 315 3 pks21 Probable polyketide synthase 21 Dictyostelium discoideum
A0A2V5GX43 7.65e-11 66 26 13 318 3 pyvA Hybrid PKS-NRPS synthetase pyvA Aspergillus violaceofuscus (strain CBS 115571)
O53901 8.16e-11 66 28 9 296 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q54FN2 8.2e-11 66 23 7 268 3 pks34 Probable polyketide synthase 34 Dictyostelium discoideum
W6QDA2 8.32e-11 66 30 6 183 1 anuA Highly reducing polyketide synthase anuA Penicillium roqueforti (strain FM164)
E9ET39 8.56e-11 66 32 5 164 2 Pks2 Polyketide synthase 2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q7TXM0 9.4e-11 66 26 7 260 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WET3 1.02e-10 66 26 8 242 1 Preu8 Non-reducing polyketide synthase Preu8 Preussia isomera
Q55CN6 1.22e-10 66 24 8 265 3 pks3 Probable polyketide synthase 3 Dictyostelium discoideum
B3FWT6 1.44e-10 65 25 10 291 1 rdc1 Non-reducing polyketide synthase rdc1 Metacordyceps chlamydosporia
D2E9X0 1.52e-10 65 26 13 329 2 DEP5 Reducing polyketide synthase DEP5 Alternaria brassicicola
B8MKY6 1.93e-10 65 24 14 342 1 tstA Highly reducing polyketide synthase tstA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q54FN7 1.94e-10 65 24 8 265 3 pks33 Probable polyketide synthase 33 Dictyostelium discoideum
A0A142C799 2.39e-10 65 30 4 170 1 phnA Non-reducing polyketide synthase phnA Penicillium herquei
B8MV59 2.4e-10 65 26 12 310 3 tpeA Partially reducing polyketide synthase tpeA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A0A0B4FLB2 2.48e-10 65 32 5 164 2 Pks2 Polyketide synthase 2 Metarhizium anisopliae (strain ARSEF 549)
Q54FQ1 3.62e-10 64 23 7 268 3 pks31 Probable polyketide synthase 31 Dictyostelium discoideum
A0A0H4ADX3 3.91e-10 64 28 7 205 2 None Non-reducing polyketide synthase PKS19 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A411PQP9 4.26e-10 64 26 11 296 3 Agnpks1 Atrochrysone carboxylic acid synthase Agnpks1 Paecilomyces divaricatus
I1S166 4.3e-10 64 26 12 338 2 FSL1 Fusarielin synthase FSL1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q5SBL6 4.34e-10 64 27 12 301 3 fsdS Fusaridione A synthetase fsdS Fusarium heterosporum
P9WES1 4.74e-10 64 27 4 203 1 None Atrochrysone carboxylic acid synthase PKS1 Calonarius odorifer
A0A0B4I1J8 4.75e-10 64 30 8 211 2 Pks2 Polyketide synthase 2 Metarhizium majus (strain ARSEF 297)
Q8J0F7 4.8e-10 64 29 9 226 1 mlcA Compactin nonaketide synthase, polyketide synthase component Penicillium citrinum
A0A8F4SKJ7 4.86e-10 64 25 9 326 1 atr1 Non-reducing polyketide synthase atr1 Stereocaulon alpinum
Q54ED7 4.96e-10 64 23 9 271 3 pks40 Probable polyketide synthase 40 Dictyostelium discoideum
E5AE40 5.28e-10 64 27 14 329 2 PKS2 Highly reducing polyketide synthase PKS2 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
P9WET5 5.54e-10 63 24 6 231 1 Preu4 Non-reducing polyketide synthase Preu4 Preussia isomera
S0EMV0 5.84e-10 63 28 15 308 1 GPY1 Highly reducing polyketide synthase GPY1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P9WET2 7.35e-10 63 25 6 231 1 Preu6 Non-reducing polyketide synthase Preu6 Preussia isomera
A0A6S5ZY48 7.72e-10 63 26 14 330 2 g433 Highly reducing polyketide synthase g433 Fusarium sp.
Q54ED6 7.94e-10 63 24 9 267 3 pks41 Probable polyketide synthase 41 Dictyostelium discoideum
Q12053 8.09e-10 63 24 5 230 1 aflC Norsolorinic acid synthase Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
Q8TGA1 9.33e-10 63 27 8 253 2 aflB Fatty acid synthase beta subunit aflB Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
Q0CS88 1.08e-09 63 28 8 212 2 tazB Highly reducing polyketide synthase tazB Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A1L9WQM9 1.09e-09 63 29 9 217 2 acrA Highly reducing polyketide synthase acrA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A0N9HNS9 1.3e-09 62 29 8 215 3 desS Desertorin synthase Aspergillus desertorum
G3XLL5 1.34e-09 62 25 5 246 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A2QUI2 1.36e-09 62 25 5 246 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q5BEJ4 1.36e-09 62 27 15 332 1 afoG Asperfuranone polyketide synthase afoG Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5KTM9 1.51e-09 62 31 10 241 1 alt5 Highly reducing polyketide synthase alt5 Alternaria solani
Q55DM7 1.51e-09 62 22 10 318 3 pks2 Probable polyketide synthase 2 Dictyostelium discoideum
Q54FQ3 1.56e-09 62 23 8 268 3 pks29 Probable polyketide synthase 29 Dictyostelium discoideum
Q86JI5 1.56e-09 62 23 12 320 2 pks5 Probable polyketide synthase 5 Dictyostelium discoideum
Q54FP8 1.57e-09 62 24 10 269 3 pks32 Probable polyketide synthase 32 Dictyostelium discoideum
A0A0B4H8J1 1.64e-09 62 28 7 225 2 Pks2 Polyketide synthase 2 Metarhizium brunneum (strain ARSEF 3297)
A0A161CEU9 1.65e-09 62 24 10 309 1 citS Citrinin polyketide synthase Monascus ruber
Q65Z23 1.65e-09 62 24 10 309 1 pksCT Citrinin polyketide synthase Monascus purpureus
G4N296 2.23e-09 62 29 5 191 2 PKS19 Highly reducing polyketide synthase 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
G0R6S9 2.31e-09 62 23 10 299 2 sor2 Non-reducing polyketide synthase sor2 Hypocrea jecorina (strain QM6a)
S0DRI1 2.4e-09 62 25 7 217 1 FUB1 Reducing polyketide synthase FUB1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S3D9F1 2.62e-09 62 27 12 316 1 gloL Highly reducing polyketide synthase gloL Glarea lozoyensis (strain ATCC 20868 / MF5171)
D7PI15 2.64e-09 62 24 8 273 1 gsfA Non-reducing polyketide synthase gsfA Penicillium aethiopicum
Q5BBP5 2.84e-09 62 27 13 282 1 pkhB Highly reducing polyketide synthase pkhB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5B7U4 2.91e-09 62 25 12 296 1 pkiA Non-reducing polyketide synthase pkiA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5ATG8 2.94e-09 62 26 9 303 1 apdA Hybrid PKS-NRPS synthetase apdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0R1E8 2.97e-09 62 25 7 290 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q54FQ2 3.06e-09 62 24 10 272 3 pks30 Probable polyketide synthase 30 Dictyostelium discoideum
W7MLD7 3.72e-09 61 27 14 324 1 FUS1 Fusarin C synthetase Gibberella moniliformis (strain M3125 / FGSC 7600)
Q0C9L7 4.44e-09 61 33 5 139 1 ctvA Highly reducing polyketide synthase ctvA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P9WEQ0 4.56e-09 61 34 6 151 3 olcA Non-reducing polyketide synthase olcA Penicillium canescens
E9EHG2 4.56e-09 61 26 13 313 2 Pks2 Polyketide synthase 2 Metarhizium acridum (strain CQMa 102)
A0A1L9UCG2 4.76e-09 61 24 5 246 3 albA Non-reducing polyketide synthase albA Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
Q02251 5.29e-09 61 28 6 209 1 mas Mycocerosic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
S4W172 1.01e-08 60 30 10 223 1 eqxS Equisetin synthetase eqxS Fusarium heterosporum
A1CFL8 1.02e-08 60 24 10 316 1 patK 6-methylcalicylic acide synthase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
P9WEZ4 1.09e-08 60 26 12 308 2 pytA Hybrid PKS-NRPS synthetase pytA Aspergillus terreus
A0A2P1DP91 1.13e-08 60 26 11 312 1 macA 6-methylsalicylic acid synthase Penicillium terrestre
A0A097ZPE0 1.17e-08 60 27 8 232 1 andM Non-reducing polyketide synthase andM Emericella variicolor
A0A0D2YG10 1.26e-08 60 25 7 217 1 FUB1 Reducing polyketide synthase FUB1 Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936)
A0A7L9EYL1 1.63e-08 59 29 6 223 1 xenE Hybrid PKS-NRPS synthetase xenE Xenoacremonium sinensis
P9WET8 1.71e-08 59 24 11 329 2 Preu1 Highly reducing polyketide synthase Preu1 Preussia isomera
Q5BG07 1.75e-08 59 23 9 328 1 pkdA Non-reducing polyketide synthase pkdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54G30 1.79e-08 59 23 8 313 3 pks27 Probable polyketide synthase 27 Dictyostelium discoideum
B6F209 1.88e-08 59 25 10 313 1 cpaA Cyclo-acetoacetyl-L-tryptophan synthase Aspergillus oryzae
A0A3G9H990 1.88e-08 59 28 13 304 1 ALT1 Highly reducing polyketide synthase ALT1 Alternaria alternata
A2R6H1 2.04e-08 59 25 14 308 2 otaA Highly reducing polyketide synthase otaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
L7X8J4 2.52e-08 58 26 13 318 1 curS1 Highly reducing polyketide synthase curS1 Aspergillus terreus
Q7SHI6 2.56e-08 58 26 11 297 2 srdA Highly reducing polyketide synthase srdA Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
B1GVX7 2.81e-08 58 28 13 321 2 BOA6 Reducing polyketide synthase BOA6 Botryotinia fuckeliana (strain B05.10)
B8N8R0 2.82e-08 58 25 6 227 2 afvB Non-reducing polyketide synthase afvB Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
P9WET7 2.95e-08 58 25 13 338 2 Preu2 Reducing polyketide synthase Preu2 Preussia isomera
B3FWT3 3.2e-08 58 27 12 306 1 hpm8 Reducing polyketide synthase hmp8 Hypomyces subiculosus
A0A1R3RGK0 3.31e-08 58 27 16 303 1 otaA Highly reducing polyketide synthase otaA Aspergillus carbonarius (strain ITEM 5010)
G3Y419 3.47e-08 58 24 10 288 1 yanA 6-methylsalicylic acid synthase Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
G3J453 3.56e-08 58 26 13 317 1 cm3B Highly reducing polyketide synthase cm3B Cordyceps militaris (strain CM01)
W7MT31 3.87e-08 58 24 7 217 1 FUB1 Reducing polyketide synthase FUB1 Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A7R7ZK98 4.01e-08 58 25 11 314 3 AcPKS Atrochrysone carboxylic acid synthase Aspergillus chevalieri
P9WET6 4.41e-08 58 24 7 290 1 Preu3 Non-reducing polyketide synthase Preu3 Preussia isomera
Q54FI3 5.34e-08 58 25 6 174 1 StlB Polyketide synthase 37 Dictyostelium discoideum
Q3S2T9 5.7e-08 57 28 9 229 1 mokA Lovastatin nonaketide synthase mokA Monascus pilosus
P96202 6.07e-08 57 26 11 298 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TXL8 6.07e-08 57 26 11 298 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A345BJP0 7.03e-08 57 25 13 302 3 clz2 Squalestatin tetraketide synthase clz2 Cochliobolus lunatus
A0A6F9DXA0 7.92e-08 57 27 13 314 1 men1 Partially reducing polyketide synthase men1 Menisporopsis theobromae
A0A1L9WN37 9.13e-08 57 23 10 305 1 acuA 6-methylsalicylic acid synthase acuA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A8F4S8Q3 1.01e-07 57 26 5 221 1 gkaA Hybrid PKS-NRPS synthetase gkaA Penicillium citrinum
S0DZM7 1.04e-07 57 24 8 243 1 bik1 Bikaverin polyketide synthase bik1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
A0A098D8A0 1.06e-07 57 26 14 330 2 ZEA2 Highly reducing polyketide synthase ZEA2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A1L7U4V5 1.13e-07 57 27 8 226 2 FMN1 Reducing polyketide synthase 8 Fusarium mangiferae
P0DUT7 1.18e-07 57 25 12 308 1 Ba17a Highly reducing polyketide synthase 17 Metarhizium anisopliae
I6X8D2 1.23e-07 57 27 6 198 1 pks13 Polyketide synthase Pks13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
S0EEY3 1.34e-07 56 27 13 310 1 FUS1 Fusarin C synthetase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
K3VA96 1.47e-07 56 23 7 319 3 PKS40 Highly reducing polyketide synthase 40 Fusarium pseudograminearum (strain CS3096)
Q54QD3 1.5e-07 56 22 14 323 3 pks22 Probable polyketide synthase 22 Dictyostelium discoideum
A0A0E4AZP0 1.62e-07 56 29 10 223 3 fsa1 Hybrid PKS-NRPS synthetase fsa1 Fusarium sp. (strain FN080326)
P9WQE9 1.81e-07 56 28 8 225 1 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE8 1.81e-07 56 28 8 225 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9F4 1.81e-07 56 28 8 225 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KQG0 1.81e-07 56 28 8 225 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TVK8 1.81e-07 56 28 8 225 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B3FWU0 1.82e-07 56 25 13 312 1 rdc5 Reducing polyketide synthase rdc5 Metacordyceps chlamydosporia
A0A1B4XBH3 2.22e-07 56 28 16 317 3 sdnO Highly reducing polyketide synthase sdnO Sordaria araneosa
Q54QD1 2.64e-07 55 21 12 319 3 pks23 Probable polyketide synthase 23 Dictyostelium discoideum
B0G170 2.75e-07 55 23 9 313 3 pks28 Probable polyketide synthase 28 Dictyostelium discoideum
G4NEB1 3.84e-07 55 24 12 344 1 NEC1 Highly reducing polyketide synthase NEC1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A0A0S2CHA9 3.86e-07 55 20 9 296 1 pigA Non-reducing polyketide synthase pigA Monascus ruber
A2QX22 3.9e-07 55 27 7 270 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A1CLY8 4.29e-07 55 26 11 303 3 ccsA Polyketide synthase-nonribosomal peptide synthetase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q6DQW3 4.88e-07 55 31 6 144 1 CTB1 Non-reducing polyketide synthase CTB1 Cercospora nicotianae
A0A068ABB7 7.02e-07 54 25 10 308 1 Bref-PKS Highly reducing polyketide synthase Eupenicillium brefeldianum
Q0CZH1 7.67e-07 53 29 8 184 2 pytA Hybrid PKS-NRPS synthetase pytA (Fragment) Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A1V6NYI6 7.93e-07 54 30 9 219 3 verA Highly reducing polyketide synthase verA Penicillium polonicum
F1DBA9 8.12e-07 54 25 8 262 1 mpaC Non-reducing polyketide synthase mapC Penicillium brevicompactum
A0A2G5IC96 8.27e-07 54 31 6 144 3 CTB1 Non-reducing polyketide synthase CTB1 Cercospora beticola
Q9Y7D5 8.82e-07 54 25 13 314 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus
A0A482N9V7 9.22e-07 54 27 9 217 1 iccA Hybrid PKS-NRPS synthetase iccA Talaromyces variabilis
Q54KU3 1.14e-06 53 21 10 307 3 pks25 Probable polyketide synthase 25 Dictyostelium discoideum
A2QK66 1.15e-06 53 27 10 279 3 ktnS Kotanin synthase Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A0A2Z5XAL7 1.2e-06 53 29 8 225 1 phm1 Hybrid PKS-NRPS synthetase phm1 Pyrenochaetopsis sp.
A0A411KUP8 1.26e-06 53 26 11 327 1 ucsA Hybrid PKS-NRPS synthetase ucsA Acremonium sp.
A0A8D5M692 1.39e-06 53 25 3 168 1 esdpA Non-reducing polyketide synthase esdpA Penicillium shearii
Q0CRQ5 1.58e-06 53 24 6 215 1 ATEG_03629 5-methylorsellinic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A481WR96 1.62e-06 53 24 10 311 3 claI Highly reducing polyketide synthase claI Penicillium crustosum
Q2HBN0 1.72e-06 53 28 6 214 1 cghG Hybrid PKS-NRPS synthetase cghG Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A0A0D1DNX1 1.89e-06 53 32 8 156 2 fas2 Fatty acid synthase 2 Ustilago maydis (strain 521 / FGSC 9021)
G3KLH6 1.91e-06 53 26 8 273 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger
Q5ATJ7 1.96e-06 53 23 8 236 1 ausA Non-reducing polyketide synthase ausA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
D9N1A1 2.03e-06 53 23 9 313 2 ACTTS3 Highly reducing polyketide synthase ACTTS3 Alternaria alternata
A0A0Y0M151 2.1e-06 53 26 13 327 1 cla2 Highly reducing polyketide synthase cla2 Cladosporium cladosporioides
Q8J0F5 2.11e-06 53 25 11 317 1 mlcB Compactin diketide synthase mlcB Penicillium citrinum
Q0C8M3 2.23e-06 53 26 7 222 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A075TRC0 2.28e-06 52 25 12 320 1 patK 6-methylsalicylic acid synthase Penicillium expansum
A0A4P8DJV2 2.36e-06 52 24 10 311 3 dmxL2 Highly reducing polyketide synthase dmxL2 Cryptosporiopsis sp. (strain 8999)
Q50LG3 2.55e-06 52 28 11 232 3 AFT9-1 Highly reducing polyketide synthase AFT9-1 Alternaria alternata
A0A017SEX7 2.87e-06 52 28 8 193 1 fogA Highly reducing polyketide synthase fogA Aspergillus ruber (strain CBS 135680)
Q869W9 2.91e-06 52 26 7 188 2 pks16 Probable polyketide synthase 16 Dictyostelium discoideum
N4WHA7 2.95e-06 52 28 10 215 3 PKS2 Reducing polyketide synthase PKS2 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
Q9Y8A5 2.97e-06 52 25 9 276 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus
A0A0M4L8I7 3.15e-06 52 26 6 223 1 aurA Highly reducing polyketide synthase aurA Calcarisporium arbuscula
A0A6J4B487 3.47e-06 52 26 9 260 3 LUC5 Hybrid PKS-NRPS synthetase LUC5 Fusarium sp.
A0A384XH94 3.53e-06 52 24 7 222 1 stpks1 Highly reducing polyketide synthase stpks1 Strobilurus tenacellus
S7Z800 4e-06 52 25 14 316 3 opdA Hybrid PKS-NRPs synthetase opdA Penicillium oxalicum (strain 114-2 / CGMCC 5302)
A0A3G1DJF3 4.01e-06 52 28 9 198 2 pks2 Squalestatin hexaketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
P0DUK1 4.07e-06 52 23 9 306 3 pspA Highly reducing polyketide synthase pspA Penicillium soppii
A0A8F4S6Z6 4.08e-06 52 25 5 226 1 pydA Hybrid PKS-NRPS synthetase pydA Acremonium sp.
Q54KU5 4.33e-06 52 21 10 307 3 pks24 Probable polyketide synthase 24 Dictyostelium discoideum
A0A0U5GFS8 4.56e-06 52 25 7 230 1 ausA Non-reducing polyketide synthase ausA Aspergillus calidoustus
E9F5E7 4.64e-06 52 26 4 182 1 subA Non-reducing polyketide synthase subA Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A1L7U3D7 4.9e-06 52 25 11 328 2 FPY1 Highly reducing polyketide synthase 40 Fusarium mangiferae
Q559A9 5.14e-06 52 21 7 268 3 pks13 Probable polyketide synthase 13 Dictyostelium discoideum
A0A089FSA4 5.31e-06 52 29 8 228 3 prlS Hybrid PKS-NRPS synthetase prlS Fungal sp. (strain NRRL 50135)
B8NJG3 6.63e-06 51 25 11 305 3 lepA Hybrid PKS-NRPS synthetase lepA Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A345BJN0 6.94e-06 51 29 9 194 1 clz14 Squalestatin hexaketide synthase clz14 Cochliobolus lunatus
A0A0R8YWJ7 7.13e-06 51 23 8 243 1 mpas Methylphloroacetophenone synthase Cladonia uncialis
Q4WAZ9 7.78e-06 51 26 14 341 2 NRPS14 PKS-NRPS hybrid synthetase psoA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A0U5GK88 8.82e-06 51 26 11 324 1 ausV Highly reducing polyketide synthase ausV Aspergillus calidoustus
G1XU04 8.86e-06 51 25 9 275 1 AOL_s00215g283 6-methylsalicylic acid synthase AOL_s00215g283 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)
Q0V6Q6 1.05e-05 50 23 9 315 1 phmA Polyketide synthase-nonribosomal peptide synthetase phmA Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
P22367 1.1e-05 50 24 11 319 1 None 6-methylsalicylic acid synthase Penicillium patulum
A0A084R1H6 1.36e-05 50 27 7 218 3 ATR6 Highly reducing polyketide synthase ATR6 Stachybotrys chlorohalonata (strain IBT 40285)
P9WEX6 1.46e-05 50 29 3 125 1 dpmaA Non-reducing polyketide synthase dpmaA Metarhizium anisopliae
A0A0A2JW91 1.52e-05 50 25 11 317 1 cnsI Highly reducing polyketide synthase cnsI Penicillium expansum
S0DS59 1.92e-05 50 29 7 167 2 PKS-NRPS1 Trichosetin synthetase PKS-NRPS1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q55E72 2.17e-05 50 25 8 183 1 stlA Probable polyketide synthase 1 Dictyostelium discoideum
Q54TW0 2.2e-05 49 23 7 211 2 pks18 Probable polyketide synthase 18 Dictyostelium discoideum
B6HV32 2.23e-05 49 21 8 308 1 adrD Non-reducing polyketide synthase adrD Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
N4WHE3 2.23e-05 49 25 5 204 3 PKS1 Reducing polyketide synthase PKS1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
G3JUI8 2.66e-05 49 25 6 244 1 milA Highly reducing polyketide synthase milA Cordyceps militaris (strain CM01)
Q0D159 2.85e-05 49 27 8 234 2 ATEG_00325 Hybrid PKS-NRPS synthetase ATEG_00325 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
J4KMC1 2.86e-05 49 25 13 343 1 tenS Tenellin synthetase Beauveria bassiana (strain ARSEF 2860)
A0A0N7D4P6 3.29e-05 49 23 11 320 2 Dhc3 Highly reducing polyketide synthase Dhc3 Alternaria cinerariae
A0A0A0RM07 4.37e-05 48 24 12 256 1 MLNS Mellein synthase Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q4WLD4 4.6e-05 48 26 8 208 1 pyr2 Non-reducing polyketide synthase pyr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0JJU1 5.09e-05 48 25 15 343 1 tenS Tenellin synthetase Beauveria bassiana
C5H885 5.3e-05 48 24 15 334 3 rads1 Reducing polyketide synthase rads1 Floropilus chiversii
A0A125R003 5.82e-05 48 23 8 248 1 cla3 Non-reducing polyketide synthase cla3 Cladosporium cladosporioides
Q4WAY3 6.22e-05 48 29 9 227 1 af370 Fumagillin dodecapentaenoate synthase af370 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P0DO30 6.22e-05 48 28 10 216 1 iliA Hybrid PKS-NRPS synthetase iliA Neonectria sp. (strain DH2)
Q558Y6 7.12e-05 48 22 10 268 3 pks14 Probable polyketide synthase 14 Dictyostelium discoideum
A0A0U4ZX08 7.47e-05 48 25 9 322 1 drtA Low-reducing polyketide synthase drtA Aspergillus calidoustus
A0A455R5P9 7.47e-05 48 23 8 243 1 ascC Non-reducing polyketide synthase ascC Acremonium egyptiacum
A0A167LUQ4 7.56e-05 48 26 15 316 3 fumoS Fumosorinone synthetase Cordyceps fumosorosea (strain ARSEF 2679)
A0A2Z5TM64 0.000102 47 25 9 308 3 himA Polyketide synthase-nonribosomal peptide synthetase hybrid himA Aspergillus japonicus
K2QVI8 0.000102 47 26 4 145 1 dpmpA Non-reducing polyketide synthase dpmpA Macrophomina phaseolina (strain MS6)
Q869X2 0.000106 47 27 8 188 3 pks17 Probable polyketide synthase 17 Dictyostelium discoideum
Q54D44 0.000109 47 25 6 181 3 pks42 Probable polyketide synthase 42 Dictyostelium discoideum
P12276 0.00011 47 26 10 292 1 FASN Fatty acid synthase Gallus gallus
Q2ABP6 0.000124 47 25 16 342 1 pksF Reducing polyketide synthase pksF Alternaria solani
Q00706 0.000127 47 28 7 170 2 stcK Fatty acid synthase beta subunit stcK Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A455LLX1 0.000141 47 26 13 317 1 atnH Highly reducing polyketide synthase atnH Arthrinium sp.
P34731 0.000144 47 41 3 78 1 FAS1 Fatty acid synthase subunit beta Candida albicans
Q0CJ59 0.000147 47 23 9 242 1 atX 6-methylsalicylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
B6QK81 0.000183 47 21 9 299 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN6 0.000183 47 21 9 299 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei
Q54IX3 0.000188 47 21 9 302 3 pks26 Probable polyketide synthase 26 Dictyostelium discoideum
A0A179H0J7 0.000202 47 27 5 194 2 lcsC Highly reducing polyketide synthase lcsC Purpureocillium lilacinum
A0A2I1BSV9 0.000238 46 24 9 301 1 nvfA Non-reducing polyketide synthase nvfA Aspergillus novofumigatus (strain IBT 16806)
G0REX6 0.000239 46 26 6 216 1 iliA Hybrid PKS-NRPS synthetase iliA Hypocrea jecorina (strain QM6a)
A0A193PS74 0.000305 46 21 10 323 1 stbA Non-reducing polyketide synthase stbA Stachybotrys bisbyi
B0G103 0.00031 46 22 4 171 3 pks10 Probable polyketide synthase 10 Dictyostelium discoideum
G9N4B2 0.000349 46 26 14 314 1 virA Highly reducing polyketide synthase virA Hypocrea virens (strain Gv29-8 / FGSC 10586)
A0A7L8UVC9 0.000417 45 25 12 317 3 ffsA Polyketide synthase-nonribosomal peptide synthetase ffsA Aspergillus flavipes
A0A089QRB9 0.000488 45 27 9 268 1 msl3 Mycolipanoate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A4P8WAE5 0.000533 45 31 5 130 3 pyiS Polyketide synthase-nonribosomal peptide synthetase pyiS Pyricularia grisea
P34229 0.000602 45 33 6 143 3 FAS1 Fatty acid synthase subunit beta Yarrowia lipolytica (strain CLIB 122 / E 150)
M2YKT6 0.000624 45 25 8 240 2 hps1 Hybrid PKS-NRPS synthetase 1 Dothistroma septosporum (strain NZE10 / CBS 128990)
B6H999 0.000793 45 26 8 224 1 xilA Highly reducing polyketide synthase xilA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
B4XYB8 0.000801 45 27 9 266 1 aziB 5-methyl-1-naphthoate synthase Streptomyces sahachiroi
Q558W4 0.000826 45 20 7 244 3 pks15 Probable polyketide synthase 15 Dictyostelium discoideum
Q84HC6 0.001 44 27 12 280 1 ncsB Neocarzinostatin naphthoate synthase Streptomyces carzinostaticus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07515
Feature type CDS
Gene fabD
Product ACP S-malonyltransferase
Location 1570238 - 1571170 (strand: -1)
Length 933 (nucleotides) / 310 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_350
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00698 Acyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0331 Lipid transport and metabolism (I) I Malonyl CoA-acyl carrier protein transacylase

Kegg Ortholog Annotation(s)

Protein Sequence

MSVYAMVFPGQGSQSVGMLAELAAHFPVVQATFAEASAELGYDLWALVQNGPEDELNKTWQTQPALLAASVAVWRVWLENNGAMPALMAGHSLGEYSALVCAGVIDFKEAIKLVELRGRLMQEAVPAGVGAMYAIIGLDNDAIANACKEAAQGQVVSPVNFNSPGQVVIAGEKDAVERAAALCKEAGAKRALPLSVSVPSHCALMQPAAEKLAVALKNITFNSPNFSVVNNVDVKIETSADAIRDALVRQLFNPVRWTETVEFMAAQDVEDLLEAGPGKVLTGLTKRIVKTLTSSAVNDMASLTTALENR

Flanking regions ( +/- flanking 50bp)

TGCCTGGGGTTCTGCTTTAATTCGTTTTTAATTTTTCAGGAAGATAATTCATGTCTGTATACGCAATGGTATTTCCCGGTCAGGGCTCTCAGTCTGTGGGTATGCTGGCTGAACTGGCTGCACACTTTCCGGTCGTTCAGGCAACATTTGCCGAAGCATCAGCTGAACTGGGCTATGATTTATGGGCACTCGTGCAGAACGGGCCTGAAGATGAACTGAATAAAACCTGGCAGACTCAGCCTGCACTGTTAGCAGCCTCTGTTGCTGTCTGGCGTGTCTGGCTGGAAAATAACGGTGCAATGCCCGCACTGATGGCGGGTCACAGCTTAGGTGAATATTCCGCGCTGGTGTGTGCCGGGGTGATTGATTTTAAAGAAGCCATCAAACTGGTCGAATTACGCGGACGCCTGATGCAGGAAGCCGTTCCGGCCGGGGTCGGCGCCATGTACGCGATCATCGGTCTGGATAATGACGCCATTGCCAATGCGTGTAAAGAAGCGGCTCAGGGGCAGGTTGTTTCCCCGGTTAACTTTAACTCACCGGGCCAGGTTGTTATCGCCGGTGAAAAAGACGCCGTTGAACGTGCCGCGGCATTATGTAAAGAAGCCGGTGCAAAACGTGCGCTGCCATTATCGGTCAGTGTACCGTCACATTGTGCATTAATGCAGCCGGCTGCTGAAAAATTAGCCGTTGCGCTAAAAAATATCACATTTAATTCACCAAACTTTTCGGTTGTGAACAATGTTGATGTTAAGATAGAGACATCCGCCGACGCAATTCGTGATGCATTAGTCCGTCAGCTTTTCAATCCGGTCCGCTGGACAGAAACTGTTGAGTTTATGGCCGCACAGGATGTTGAAGATCTGCTGGAAGCAGGCCCGGGTAAAGTTCTGACAGGACTGACCAAGCGTATTGTGAAAACATTAACATCATCCGCTGTCAATGATATGGCATCATTAACGACAGCTCTTGAAAATCGCTGAGGCTGAGATGAGCTTTGAAGGAAAAATTGCCCTTGTTACCGGCGCAAGCC