Homologs in group_2021

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14885 FBDBKF_14885 77.5 Morganella morganii S1 rsuA 16S rRNA pseudouridine(516) synthase RsuA
EHELCC_15690 EHELCC_15690 77.5 Morganella morganii S2 rsuA 16S rRNA pseudouridine(516) synthase RsuA
NLDBIP_16220 NLDBIP_16220 77.5 Morganella morganii S4 rsuA 16S rRNA pseudouridine(516) synthase RsuA
LHKJJB_15620 LHKJJB_15620 77.5 Morganella morganii S3 rsuA 16S rRNA pseudouridine(516) synthase RsuA
HKOGLL_14740 HKOGLL_14740 77.5 Morganella morganii S5 rsuA 16S rRNA pseudouridine(516) synthase RsuA
F4V73_RS07685 F4V73_RS07685 73.6 Morganella psychrotolerans rsuA 16S rRNA pseudouridine(516) synthase RsuA

Distribution of the homologs in the orthogroup group_2021

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2021

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZGM2 5.29e-134 379 75 0 233 3 rsuA Ribosomal small subunit pseudouridine synthase A Yersinia pestis
P0AA46 2.56e-131 372 75 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Shigella flexneri
P0AA43 2.56e-131 372 75 0 230 1 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli (strain K12)
P0AA44 2.56e-131 372 75 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA45 2.56e-131 372 75 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli O157:H7
P65840 1.08e-129 368 73 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65841 1.08e-129 368 73 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Salmonella typhi
P45124 5.56e-97 285 57 0 230 1 rsuA Ribosomal small subunit pseudouridine synthase A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KRK5 2.32e-92 273 59 1 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CPN4 1.14e-89 267 55 0 231 3 rsuA Ribosomal small subunit pseudouridine synthase A Pasteurella multocida (strain Pm70)
Q8D8X2 9.97e-88 262 56 2 232 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio vulnificus (strain CMCP6)
Q87QD4 1.71e-85 256 55 2 232 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9I5J6 8.93e-62 196 44 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O66829 4.93e-45 153 39 5 235 3 aq_554 Uncharacterized RNA pseudouridine synthase aq_554 Aquifex aeolicus (strain VF5)
O32068 9.73e-44 150 42 6 228 3 ytzG Uncharacterized RNA pseudouridine synthase YtzG Bacillus subtilis (strain 168)
Q55578 7.62e-33 122 35 8 239 3 slr0361 Uncharacterized RNA pseudouridine synthase slr0361 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O51155 4.31e-28 110 27 5 234 3 BB_0129 Uncharacterized RNA pseudouridine synthase BB_0129 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P35159 6.48e-28 109 28 4 236 1 rluB Ribosomal large subunit pseudouridine synthase B Bacillus subtilis (strain 168)
O05668 3.32e-27 107 33 6 237 3 ML1370 Uncharacterized RNA pseudouridine synthase ML1370 Mycobacterium leprae (strain TN)
O67444 3.45e-27 107 28 4 235 3 aq_1464 Uncharacterized RNA pseudouridine synthase aq_1464 Aquifex aeolicus (strain VF5)
P65843 6.8e-27 107 33 6 237 3 BQ2027_MB1738 Uncharacterized RNA pseudouridine synthase Mb1738 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ1 6.8e-27 107 33 6 237 1 Rv1711 Uncharacterized RNA pseudouridine synthase Rv1711 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ0 6.8e-27 107 33 6 237 3 MT1751.1 Uncharacterized RNA pseudouridine synthase MT1751.1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8PQN3 9.7e-25 99 36 3 176 3 rluE Ribosomal large subunit pseudouridine synthase E Xanthomonas axonopodis pv. citri (strain 306)
P32684 4.63e-23 97 29 6 233 1 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli (strain K12)
Q8FB47 6.65e-23 97 29 6 233 3 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X4L9 7.53e-23 97 29 6 233 3 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli O157:H7
Q83IR6 9.46e-23 96 29 6 233 3 rluF Dual-specificity RNA pseudouridine synthase RluF Shigella flexneri
Q8L960 1.08e-22 98 27 5 248 1 SVR1 Putative ribosomal large subunit pseudouridine synthase SVR1, chloroplastic Arabidopsis thaliana
Q8Z1V3 2.43e-22 95 30 6 233 3 rluF Dual-specificity RNA pseudouridine synthase RluF Salmonella typhi
Q8ZKL1 2.61e-22 95 30 6 233 3 rluF Dual-specificity RNA pseudouridine synthase RluF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FHV4 8.05e-22 94 28 6 245 3 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8ZEG0 8.24e-22 94 28 5 243 3 rluB Ribosomal large subunit pseudouridine synthase B Yersinia pestis
P59815 1.29e-21 93 28 6 245 3 rluB Ribosomal large subunit pseudouridine synthase B Shigella flexneri
Q8X4Q8 1.29e-21 93 28 6 245 3 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli O157:H7
P37765 1.54e-21 93 28 6 245 1 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli (strain K12)
Q8Z7D5 4.63e-21 92 28 6 245 3 rluB Ribosomal large subunit pseudouridine synthase B Salmonella typhi
Q8ZP51 5.13e-21 92 28 6 245 3 rluB Ribosomal large subunit pseudouridine synthase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8PDR2 9e-20 86 35 4 176 3 rluE Ribosomal large subunit pseudouridine synthase E Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9HX48 1.57e-19 85 34 5 178 3 rluE Ribosomal large subunit pseudouridine synthase E Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8X724 2.61e-19 86 35 5 182 3 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli O157:H7
P44827 3.64e-19 86 34 8 187 3 rluE Ribosomal large subunit pseudouridine synthase E Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P75966 4.34e-19 85 34 5 182 1 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli (strain K12)
Q9CKK7 4.84e-19 85 31 10 219 3 rluE Ribosomal large subunit pseudouridine synthase E Pasteurella multocida (strain Pm70)
Q83LF6 5.51e-19 85 34 5 182 3 rluE Ribosomal large subunit pseudouridine synthase E Shigella flexneri
Q8FIB6 8.8e-19 84 34 5 182 3 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9HZ55 8.23e-18 84 27 7 241 3 rluB Ribosomal large subunit pseudouridine synthase B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1RJR2 1.33e-17 81 26 6 230 3 RBE_0321 Uncharacterized RNA pseudouridine synthase RBE_0321 Rickettsia bellii (strain RML369-C)
Q9KSS7 5.6e-17 81 27 4 238 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45104 1.08e-16 81 27 5 240 1 rluB Ribosomal large subunit pseudouridine synthase B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8ZFQ3 1.1e-16 79 32 6 184 3 rluE Ribosomal large subunit pseudouridine synthase E Yersinia pestis
P57369 1.32e-16 79 25 5 239 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q68WJ1 1.42e-16 79 24 6 235 3 RT0532 Uncharacterized RNA pseudouridine synthase RT0532 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9CMY9 2.26e-16 80 25 5 243 3 rluB Ribosomal large subunit pseudouridine synthase B Pasteurella multocida (strain Pm70)
Q92HG4 2.41e-16 78 24 6 230 3 RC0807 Uncharacterized RNA pseudouridine synthase RC0807 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8DAS3 4.95e-16 77 32 5 182 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio vulnificus (strain CMCP6)
Q87QY8 5.39e-16 77 32 5 179 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8ZPZ1 7.98e-16 76 32 6 186 3 rluE Ribosomal large subunit pseudouridine synthase E Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7G6 2.01e-15 75 32 6 186 3 rluE Ribosomal large subunit pseudouridine synthase E Salmonella typhi
Q9ZD06 2.14e-15 75 23 6 230 3 RP544 Uncharacterized RNA pseudouridine synthase RP544 Rickettsia prowazekii (strain Madrid E)
Q4UL59 2.89e-15 75 23 6 230 3 RF_0863 Uncharacterized RNA pseudouridine synthase RF_0863 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q87NB7 6.06e-15 75 26 4 238 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P72581 8.97e-15 74 30 8 207 3 slr0612 Uncharacterized RNA pseudouridine synthase slr0612 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P42395 1.01e-14 74 25 6 247 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8P8M6 1.19e-14 75 28 7 245 3 rluB Ribosomal large subunit pseudouridine synthase B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PK58 2.63e-14 75 28 7 243 3 rluB Ribosomal large subunit pseudouridine synthase B Xanthomonas axonopodis pv. citri (strain 306)
Q8D8C0 5.07e-14 73 25 6 243 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio vulnificus (strain CMCP6)
Q9F855 5.74e-14 72 32 8 183 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9ZJG0 1.15e-13 71 25 9 251 3 jhp_1352 Uncharacterized RNA pseudouridine synthase jhp_1352 Helicobacter pylori (strain J99 / ATCC 700824)
Q87BI2 1.27e-13 72 28 7 242 3 rluB Ribosomal large subunit pseudouridine synthase B Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PAP2 1.31e-13 72 28 7 242 3 rluB Ribosomal large subunit pseudouridine synthase B Xylella fastidiosa (strain 9a5c)
P55986 2.4e-13 70 24 9 251 3 HP_1459 Uncharacterized RNA pseudouridine synthase HP_1459 Helicobacter pylori (strain ATCC 700392 / 26695)
Q89AL1 5.54e-13 69 24 5 240 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O67638 2.52e-05 47 23 9 240 3 aq_1758 Uncharacterized RNA pseudouridine synthase aq_1758 Aquifex aeolicus (strain VF5)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04065
Feature type CDS
Gene rsuA
Product 16S rRNA pseudouridine(516) synthase RsuA
Location 910579 - 911283 (strand: 1)
Length 705 (nucleotides) / 234 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2021
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase
PF01479 S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1187 Translation, ribosomal structure and biogenesis (J) J Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06183 16S rRNA pseudouridine516 synthase [EC:5.4.99.19] - -

Protein Sequence

MRLDKFLSQQLGISRNLVARELRAGLVTIDGEMVKTGATKITPEQEVAYDGNVLTQILGPRYFMLNKPIGYVCSTDDPVNPTILYFIDEPLAHKLHAAGRLDIDTTGLVLLTDNGQWSHRITAPKHHCEKTYVVTLEQPIATDVAEKFKTGVQLNGEKELTKPATLEVITPTEVKLTISEGKYHQVKRMFAAVGNHVVALHRERIGDITLDDALAPGEYRPLTEEEINSIHLPK

Flanking regions ( +/- flanking 50bp)

TAATAGATGCCTCATATCAGATGGTACTCTTCCATTTTTCAGAGAAATTCATGCGATTAGATAAATTTTTATCCCAGCAATTGGGGATTAGCCGTAATTTAGTAGCTCGTGAACTTAGAGCGGGGCTCGTGACTATAGATGGTGAAATGGTAAAAACAGGTGCGACTAAAATCACACCTGAACAAGAAGTTGCTTATGATGGCAATGTGTTGACACAAATTTTAGGCCCGCGTTATTTTATGTTGAACAAACCTATTGGTTATGTGTGTTCAACGGATGATCCTGTTAACCCCACCATTCTTTATTTTATTGATGAGCCACTAGCACATAAATTACATGCTGCGGGGCGTTTAGATATAGATACTACAGGGTTAGTGTTATTAACCGATAATGGTCAATGGTCTCATCGTATAACGGCACCTAAACATCACTGTGAAAAAACGTATGTCGTAACGCTGGAACAGCCTATTGCTACGGATGTCGCTGAGAAATTTAAAACAGGTGTCCAGTTAAATGGCGAAAAAGAATTGACTAAGCCTGCTACATTGGAAGTAATAACACCGACTGAGGTAAAACTGACCATCAGTGAAGGGAAGTACCATCAAGTTAAACGTATGTTTGCTGCGGTGGGTAATCATGTTGTCGCGTTACATCGAGAGCGTATCGGTGATATCACATTAGATGATGCTTTAGCGCCAGGAGAATACCGACCGCTAACAGAAGAAGAAATCAATAGCATTCATCTACCTAAATAATAATTATATTTTGTCGTTTTTTGGAGTTTAACTGCGTGCAAGAGCAACGT