Homologs in group_1985

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14885 FBDBKF_14885 100.0 Morganella morganii S1 rsuA 16S rRNA pseudouridine(516) synthase RsuA
EHELCC_15690 EHELCC_15690 100.0 Morganella morganii S2 rsuA 16S rRNA pseudouridine(516) synthase RsuA
NLDBIP_16220 NLDBIP_16220 100.0 Morganella morganii S4 rsuA 16S rRNA pseudouridine(516) synthase RsuA
HKOGLL_14740 HKOGLL_14740 100.0 Morganella morganii S5 rsuA 16S rRNA pseudouridine(516) synthase RsuA
F4V73_RS07685 F4V73_RS07685 86.6 Morganella psychrotolerans rsuA 16S rRNA pseudouridine(516) synthase RsuA
PMI_RS04065 PMI_RS04065 77.5 Proteus mirabilis HI4320 rsuA 16S rRNA pseudouridine(516) synthase RsuA

Distribution of the homologs in the orthogroup group_1985

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1985

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AA46 1.48e-126 360 74 0 231 3 rsuA Ribosomal small subunit pseudouridine synthase A Shigella flexneri
P0AA43 1.48e-126 360 74 0 231 1 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli (strain K12)
P0AA44 1.48e-126 360 74 0 231 3 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA45 1.48e-126 360 74 0 231 3 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli O157:H7
Q8ZGM2 3.14e-126 359 73 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Yersinia pestis
P65840 5.74e-126 358 73 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65841 5.74e-126 358 73 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Salmonella typhi
P45124 1.98e-102 299 59 0 231 1 rsuA Ribosomal small subunit pseudouridine synthase A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CPN4 5.68e-94 278 60 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Pasteurella multocida (strain Pm70)
Q9KRK5 6.36e-87 259 56 1 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8D8X2 1.15e-85 256 55 2 232 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio vulnificus (strain CMCP6)
Q87QD4 3.83e-85 255 56 2 232 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9I5J6 1.67e-59 190 45 0 230 3 rsuA Ribosomal small subunit pseudouridine synthase A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O66829 1.96e-44 152 39 6 236 3 aq_554 Uncharacterized RNA pseudouridine synthase aq_554 Aquifex aeolicus (strain VF5)
O32068 2.06e-42 146 41 5 226 3 ytzG Uncharacterized RNA pseudouridine synthase YtzG Bacillus subtilis (strain 168)
P35159 2.48e-30 115 31 4 235 1 rluB Ribosomal large subunit pseudouridine synthase B Bacillus subtilis (strain 168)
Q55578 2.95e-28 110 32 8 240 3 slr0361 Uncharacterized RNA pseudouridine synthase slr0361 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O67444 3.42e-25 102 30 4 236 3 aq_1464 Uncharacterized RNA pseudouridine synthase aq_1464 Aquifex aeolicus (strain VF5)
O51155 1.13e-24 100 26 5 230 3 BB_0129 Uncharacterized RNA pseudouridine synthase BB_0129 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
O05668 1.72e-24 100 34 6 236 3 ML1370 Uncharacterized RNA pseudouridine synthase ML1370 Mycobacterium leprae (strain TN)
Q8L960 6.05e-24 101 28 5 248 1 SVR1 Putative ribosomal large subunit pseudouridine synthase SVR1, chloroplastic Arabidopsis thaliana
P65843 7.37e-24 99 34 6 233 3 BQ2027_MB1738 Uncharacterized RNA pseudouridine synthase Mb1738 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ1 7.37e-24 99 34 6 233 1 Rv1711 Uncharacterized RNA pseudouridine synthase Rv1711 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ0 7.37e-24 99 34 6 233 3 MT1751.1 Uncharacterized RNA pseudouridine synthase MT1751.1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8PQN3 1.23e-21 91 36 5 177 3 rluE Ribosomal large subunit pseudouridine synthase E Xanthomonas axonopodis pv. citri (strain 306)
Q8ZEG0 1.55e-21 94 29 5 234 3 rluB Ribosomal large subunit pseudouridine synthase B Yersinia pestis
Q8X4Q8 9.25e-21 91 30 5 230 3 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli O157:H7
P59815 1.02e-20 91 30 5 230 3 rluB Ribosomal large subunit pseudouridine synthase B Shigella flexneri
Q9HZ55 1.06e-20 92 31 8 240 3 rluB Ribosomal large subunit pseudouridine synthase B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37765 1.15e-20 91 30 5 230 1 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli (strain K12)
Q8FHV4 1.52e-20 90 30 5 230 3 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8PDR2 2.49e-20 87 38 8 177 3 rluE Ribosomal large subunit pseudouridine synthase E Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P45104 5.11e-20 90 29 4 234 1 rluB Ribosomal large subunit pseudouridine synthase B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8ZP51 1.57e-19 88 30 5 230 3 rluB Ribosomal large subunit pseudouridine synthase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7D5 1.83e-19 87 30 5 230 3 rluB Ribosomal large subunit pseudouridine synthase B Salmonella typhi
Q9CMY9 2.45e-19 88 29 4 226 3 rluB Ribosomal large subunit pseudouridine synthase B Pasteurella multocida (strain Pm70)
Q8Z1V3 3.05e-18 84 29 6 232 3 rluF Dual-specificity RNA pseudouridine synthase RluF Salmonella typhi
Q8ZKL1 3.31e-18 84 29 6 232 3 rluF Dual-specificity RNA pseudouridine synthase RluF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X4L9 1.44e-17 82 29 6 233 3 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli O157:H7
Q8FB47 1.6e-17 82 29 6 233 3 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83IR6 1.77e-17 82 29 6 233 3 rluF Dual-specificity RNA pseudouridine synthase RluF Shigella flexneri
P32684 4.09e-17 81 28 6 233 1 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli (strain K12)
Q8PK58 5.79e-17 82 32 7 226 3 rluB Ribosomal large subunit pseudouridine synthase B Xanthomonas axonopodis pv. citri (strain 306)
Q8P8M6 6.45e-17 82 30 7 242 3 rluB Ribosomal large subunit pseudouridine synthase B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q68WJ1 1.81e-16 79 21 6 240 3 RT0532 Uncharacterized RNA pseudouridine synthase RT0532 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q1RJR2 4.42e-16 77 25 6 232 3 RBE_0321 Uncharacterized RNA pseudouridine synthase RBE_0321 Rickettsia bellii (strain RML369-C)
Q87BI2 5.33e-16 79 29 7 242 3 rluB Ribosomal large subunit pseudouridine synthase B Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9HX48 5.81e-16 76 35 6 180 3 rluE Ribosomal large subunit pseudouridine synthase E Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9PAP2 6.15e-16 79 29 7 242 3 rluB Ribosomal large subunit pseudouridine synthase B Xylella fastidiosa (strain 9a5c)
Q9ZD06 6.69e-16 77 22 7 240 3 RP544 Uncharacterized RNA pseudouridine synthase RP544 Rickettsia prowazekii (strain Madrid E)
Q92HG4 1.1e-15 76 23 5 232 3 RC0807 Uncharacterized RNA pseudouridine synthase RC0807 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9KSS7 1.23e-15 77 28 5 233 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P44827 2.26e-15 75 31 5 187 3 rluE Ribosomal large subunit pseudouridine synthase E Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q87NB7 2.5e-15 76 26 4 238 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P42395 4.25e-15 75 25 6 223 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9CKK7 5.97e-15 74 31 6 187 3 rluE Ribosomal large subunit pseudouridine synthase E Pasteurella multocida (strain Pm70)
Q89AL1 1.17e-14 73 25 6 235 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57369 2.4e-14 73 22 5 241 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8DAS3 4.81e-14 72 34 8 182 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio vulnificus (strain CMCP6)
Q8D8C0 5.48e-14 73 27 4 233 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio vulnificus (strain CMCP6)
Q4UL59 5.75e-14 72 23 5 228 3 RF_0863 Uncharacterized RNA pseudouridine synthase RF_0863 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P75966 6.15e-14 71 34 9 185 1 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli (strain K12)
Q83LF6 7.85e-14 71 34 9 185 3 rluE Ribosomal large subunit pseudouridine synthase E Shigella flexneri
Q8FIB6 1.5e-13 70 34 9 185 3 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X724 5.61e-13 68 34 9 185 3 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli O157:H7
P72581 6.38e-13 69 28 6 204 3 slr0612 Uncharacterized RNA pseudouridine synthase slr0612 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8ZPZ1 8.83e-13 68 32 8 187 3 rluE Ribosomal large subunit pseudouridine synthase E Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9F855 1.89e-12 67 31 7 182 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8Z7G6 2.08e-12 67 32 8 187 3 rluE Ribosomal large subunit pseudouridine synthase E Salmonella typhi
Q8ZFQ3 7.31e-12 65 31 7 183 3 rluE Ribosomal large subunit pseudouridine synthase E Yersinia pestis
Q87QY8 2.38e-11 64 32 7 179 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9ZJG0 6.74e-11 63 25 10 247 3 jhp_1352 Uncharacterized RNA pseudouridine synthase jhp_1352 Helicobacter pylori (strain J99 / ATCC 700824)
P55986 7.81e-11 63 25 10 247 3 HP_1459 Uncharacterized RNA pseudouridine synthase HP_1459 Helicobacter pylori (strain ATCC 700392 / 26695)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15620
Feature type CDS
Gene rsuA
Product 16S rRNA pseudouridine(516) synthase RsuA
Location 8414 - 9109 (strand: 1)
Length 696 (nucleotides) / 231 (amino acids)

Contig

Accession ZDB_374
Length 116739 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1985
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase
PF01479 S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1187 Translation, ribosomal structure and biogenesis (J) J Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06183 16S rRNA pseudouridine516 synthase [EC:5.4.99.19] - -

Protein Sequence

MRLDKFLAHQMGISRNLVARELRAGMVTVDGEVVKNGALKVSAENEVAYDGNVMTHVTGPRYFMLNKPQGYVCSTDDPVNPTILYFIDEPVAHKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPKHHCEKTYRVTLAEPVADTTAALFEQGVLLNGEQHPTKPAKLEIITPQDVRLTISEGRYHQVKRMFAAAGNHVDELHRERIGGIVLDDSLAPGEYRPLTDEEIQSVL

Flanking regions ( +/- flanking 50bp)

GCTTATCAGCCGGCAGCATGCTGCGGGCGCGTCAGGTTTAAGAGACATTCATGCGATTAGATAAATTTCTTGCCCATCAGATGGGCATCAGCCGGAACCTTGTGGCCAGAGAGCTGCGTGCGGGGATGGTGACTGTGGATGGTGAGGTCGTGAAAAACGGCGCACTGAAAGTCAGCGCGGAGAACGAAGTGGCGTATGACGGCAATGTGATGACACACGTCACCGGGCCGCGCTACTTTATGCTGAATAAACCGCAGGGCTATGTCTGCTCAACGGATGATCCGGTTAACCCGACTATTCTTTATTTTATCGATGAGCCGGTTGCCCATAAACTGCATGCCGCCGGACGGCTGGATATTGATACCACCGGGCTTGTGCTGATGACTGACGACGGGCAGTGGTCGCACCGTATCACCTCACCGAAACATCATTGCGAGAAAACCTACCGCGTCACCCTGGCGGAGCCGGTGGCGGACACTACCGCAGCGCTGTTTGAGCAGGGTGTGTTACTTAACGGCGAACAGCACCCGACCAAACCGGCAAAACTCGAGATTATCACCCCGCAGGATGTGCGGCTGACGATTTCCGAAGGGCGCTATCACCAGGTCAAACGTATGTTTGCCGCTGCCGGTAACCATGTGGACGAACTGCACCGCGAGCGTATCGGCGGGATTGTGCTGGATGACAGCCTGGCGCCGGGGGAATACCGCCCGCTGACTGATGAGGAAATTCAGTCGGTTCTCTGAACACCTTTTTTACTGAATCCAATACGGAGTAACAGGCGTGCAAGTGCAAC