Homologs in group_182

Help

8 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06485 FBDBKF_06485 39.3 Morganella morganii S1 dnaJ molecular chaperone DnaJ
EHELCC_09530 EHELCC_09530 39.3 Morganella morganii S2 dnaJ molecular chaperone DnaJ
NLDBIP_09910 NLDBIP_09910 39.3 Morganella morganii S4 dnaJ molecular chaperone DnaJ
LHKJJB_07845 LHKJJB_07845 39.3 Morganella morganii S3 dnaJ molecular chaperone DnaJ
HKOGLL_07395 HKOGLL_07395 39.3 Morganella morganii S5 dnaJ molecular chaperone DnaJ
F4V73_RS15445 F4V73_RS15445 39.3 Morganella psychrotolerans dnaJ molecular chaperone DnaJ
PMI_RS00050 PMI_RS00050 40.4 Proteus mirabilis HI4320 dnaJ molecular chaperone DnaJ
PMI_RS18735 PMI_RS18735 25.9 Proteus mirabilis HI4320 - J domain-containing protein

Distribution of the homologs in the orthogroup group_182

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_182

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q1RDL6 3.17e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Escherichia coli (strain UTI89 / UPEC)
Q8FJ50 3.17e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ66 3.17e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A9Q7 3.17e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O1:K1 / APEC
B7MPT2 3.17e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O81 (strain ED1a)
B7MIE6 3.17e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNY3 3.17e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LFA9 3.24e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Escherichia coli (strain 55989 / EAEC)
Q7C254 3.66e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Shigella flexneri
Q0T634 3.66e-174 487 74 3 312 3 cbpA Curved DNA-binding protein Shigella flexneri serotype 5b (strain 8401)
Q3Z3C3 6.91e-174 486 73 2 311 3 cbpA Curved DNA-binding protein Shigella sonnei (strain Ss046)
B7N3F5 8.14e-174 486 73 2 311 3 cbpA Curved DNA-binding protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5YU43 8.23e-174 486 73 2 311 3 cbpA Curved DNA-binding protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q7AFV7 8.23e-174 486 73 2 311 3 cbpA Curved DNA-binding protein Escherichia coli O157:H7
B7NLC5 1.36e-173 485 73 2 311 3 cbpA Curved DNA-binding protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P36659 1.85e-173 485 73 3 312 1 cbpA Curved DNA-binding protein Escherichia coli (strain K12)
B1IV97 1.85e-173 485 73 3 312 3 cbpA Curved DNA-binding protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYV2 1.85e-173 485 73 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O9:H4 (strain HS)
B1X8V5 1.85e-173 485 73 3 312 3 cbpA Curved DNA-binding protein Escherichia coli (strain K12 / DH10B)
C4ZQC8 1.85e-173 485 73 3 312 3 cbpA Curved DNA-binding protein Escherichia coli (strain K12 / MC4100 / BW2952)
Q31YR1 1.93e-173 485 73 3 312 3 cbpA Curved DNA-binding protein Shigella boydii serotype 4 (strain Sb227)
B6I976 1.93e-173 485 73 3 312 3 cbpA Curved DNA-binding protein Escherichia coli (strain SE11)
B7M8Y3 1.93e-173 485 73 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O8 (strain IAI1)
A7ZKA5 1.93e-173 485 73 3 312 3 cbpA Curved DNA-binding protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32HR2 3.17e-173 484 73 3 312 3 cbpA Curved DNA-binding protein Shigella dysenteriae serotype 1 (strain Sd197)
B2TTP8 2.62e-172 482 73 3 312 3 cbpA Curved DNA-binding protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LP19 5.29e-172 481 73 3 312 3 cbpA Curved DNA-binding protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LJ04 1.31e-171 480 72 2 311 3 cbpA Curved DNA-binding protein Escherichia coli (strain SMS-3-5 / SECEC)
P63263 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63262 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella typhi
B4TSM3 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella schwarzengrund (strain CVM19633)
B5BBH2 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella paratyphi A (strain AKU_12601)
C0Q893 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella paratyphi C (strain RKS4594)
A9N6S2 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGA2 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2U5 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella newport (strain SL254)
B4TEN5 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella heidelberg (strain SL476)
B5R6G3 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R049 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella enteritidis PT4 (strain P125109)
B5FR40 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella dublin (strain CT_02021853)
B5F1Z5 4.13e-169 474 71 3 312 3 cbpA Curved DNA-binding protein Salmonella agona (strain SL483)
A9MH53 1.49e-168 473 71 3 312 3 cbpA Curved DNA-binding protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q57QP2 1.96e-168 473 71 3 312 3 cbpA Curved DNA-binding protein Salmonella choleraesuis (strain SC-B67)
A8AI78 3.9e-168 472 72 3 312 3 cbpA Curved DNA-binding protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GIL6 1.18e-143 410 64 2 314 3 cbpA Curved DNA-binding protein Serratia proteamaculans (strain 568)
B1J5W7 3.75e-118 345 56 4 316 3 cbpA Curved DNA-binding protein Pseudomonas putida (strain W619)
A5W9N6 1.48e-107 318 56 6 319 3 cbpA Curved DNA-binding protein Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88DH7 8.84e-107 317 55 6 319 3 cbpA Curved DNA-binding protein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK26 7.08e-102 304 54 5 318 3 cbpA Curved DNA-binding protein Pseudomonas putida (strain GB-1)
Q87VN8 1.13e-100 301 52 6 317 3 cbpA Curved DNA-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1I490 5.68e-99 297 53 5 320 3 cbpA Curved DNA-binding protein Pseudomonas entomophila (strain L48)
Q83CJ2 4.55e-76 238 42 6 313 3 cbpA Curved DNA-binding protein Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDK6 4.55e-76 238 42 6 313 3 cbpA Curved DNA-binding protein Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KE65 4.55e-76 238 42 6 313 3 cbpA Curved DNA-binding protein Coxiella burnetii (strain Dugway 5J108-111)
C5D4U0 1.7e-55 187 34 9 359 3 dnaJ Chaperone protein DnaJ Geobacillus sp. (strain WCH70)
B9E6X0 1.2e-53 182 32 8 361 3 dnaJ Chaperone protein DnaJ Macrococcus caseolyticus (strain JCSC5402)
C4K3I5 5.27e-53 181 32 8 366 3 dnaJ Chaperone protein DnaJ Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q9KWS6 6.5e-53 181 34 8 358 3 dnaJ Chaperone protein DnaJ Parageobacillus thermoglucosidasius
A8G9K9 2.45e-52 179 33 8 368 3 dnaJ Chaperone protein DnaJ Serratia proteamaculans (strain 568)
Q5KWZ8 2.58e-52 179 32 6 364 3 dnaJ Chaperone protein DnaJ Geobacillus kaustophilus (strain HTA426)
A4IR30 3.5e-52 179 32 7 360 3 dnaJ Chaperone protein DnaJ Geobacillus thermodenitrificans (strain NG80-2)
Q8CP18 3.76e-52 178 32 11 365 3 dnaJ Chaperone protein DnaJ Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q56237 9.17e-52 174 34 5 298 1 dnaJ2 Chaperone protein DnaJ 2 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5HNW7 1.44e-51 177 32 11 365 3 dnaJ Chaperone protein DnaJ Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2YT48 1.58e-51 177 32 9 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain bovine RF122 / ET3-1)
B4F2V6 3.53e-51 176 33 8 368 3 dnaJ Chaperone protein DnaJ Proteus mirabilis (strain HI4320)
P63972 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MW2)
A8Z4B8 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8Y8 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MSSA476)
P63971 3.61e-51 176 32 10 365 1 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain N315)
P63970 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHC2 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Newman)
Q5HFI1 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain COL)
A5ITA7 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain JH9)
Q2FXZ3 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGE4 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain USA300)
A6U251 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain JH1)
A7X2Y0 3.61e-51 176 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GGC1 4.28e-51 176 32 10 361 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MRSA252)
B9DNJ9 5.1e-51 176 31 8 365 3 dnaJ Chaperone protein DnaJ Staphylococcus carnosus (strain TM300)
P45555 1.2e-50 174 32 10 365 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus
A1JJD6 2.94e-50 174 33 8 368 3 dnaJ Chaperone protein DnaJ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A0AIS3 3.75e-50 173 31 11 369 3 dnaJ Chaperone protein DnaJ Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q1RHG9 1.46e-49 172 33 10 365 3 dnaJ Chaperone protein DnaJ Rickettsia bellii (strain RML369-C)
B5YYA8 1.71e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A1G7 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1G8 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella typhi
B4TVZ6 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella schwarzengrund (strain CVM19633)
C0Q4F4 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi C (strain RKS4594)
A9MXI3 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T6D7 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella newport (strain SL254)
B4TIB5 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella heidelberg (strain SL476)
B5RF09 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5I3 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella enteritidis PT4 (strain P125109)
B5FHA7 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella dublin (strain CT_02021853)
Q57TP2 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella choleraesuis (strain SC-B67)
B5F6Y9 1.94e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella agona (strain SL483)
Q3Z600 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Shigella sonnei (strain Ss046)
B7LVP7 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGI7 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain UTI89 / UPEC)
B1LFU5 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain SMS-3-5 / SECEC)
B6HZ11 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain SE11)
B7N7N9 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IRF9 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FLC5 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZVV8 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O9:H4 (strain HS)
B7M0B1 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O8 (strain IAI1)
B7MNM2 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O81 (strain ED1a)
B7NHB7 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8XA65 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O157:H7
B7L4D9 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain 55989 / EAEC)
B7MAD6 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UI60 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHA5 1.94e-49 171 34 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli O139:H28 (strain E24377A / ETEC)
C4L8Y4 2.26e-49 171 32 8 357 3 dnaJ Chaperone protein DnaJ Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
P0DJM1 2.49e-49 171 31 11 369 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
G2K045 2.49e-49 171 31 11 369 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 1/2a (strain 10403S)
C5B7L8 2.6e-49 171 33 7 357 3 dnaJ Chaperone protein DnaJ Edwardsiella ictaluri (strain 93-146)
B0UWR3 3.02e-49 171 31 7 357 3 dnaJ Chaperone protein DnaJ Histophilus somni (strain 2336)
Q0T8H5 3.41e-49 171 33 9 354 3 dnaJ Chaperone protein DnaJ Shigella flexneri serotype 5b (strain 8401)
B5BLH9 3.71e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi A (strain AKU_12601)
Q5PDJ4 3.71e-49 171 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q71ZJ8 3.84e-49 171 32 11 369 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4b (strain F2365)
C1KVB9 3.84e-49 171 32 11 369 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4b (strain CLIP80459)
A8GV67 4.45e-49 171 33 10 365 3 dnaJ Chaperone protein DnaJ Rickettsia bellii (strain OSU 85-389)
Q0I3V1 5.41e-49 170 31 7 357 3 dnaJ Chaperone protein DnaJ Histophilus somni (strain 129Pt)
Q326K6 5.56e-49 170 33 9 354 3 dnaJ Chaperone protein DnaJ Shigella boydii serotype 4 (strain Sb227)
B2U233 5.56e-49 170 33 9 354 3 dnaJ Chaperone protein DnaJ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B8DE39 7.1e-49 170 31 11 369 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4a (strain HCC23)
Q92BN9 7.1e-49 170 31 11 369 3 dnaJ Chaperone protein DnaJ Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q32KA4 7.17e-49 170 33 9 354 3 dnaJ Chaperone protein DnaJ Shigella dysenteriae serotype 1 (strain Sd197)
A7GT07 7.23e-49 169 33 10 362 3 dnaJ Chaperone protein DnaJ Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
P08622 8.59e-49 170 33 9 354 1 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12)
B1XBE0 8.59e-49 170 33 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12 / DH10B)
Q3IUB7 9.32e-49 170 30 9 368 3 dnaJ Chaperone protein DnaJ Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
C4ZPU1 1.26e-48 169 33 9 354 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12 / MC4100 / BW2952)
B1JL03 1.29e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66ES9 1.29e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQF8 1.29e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pestis (strain Pestoides F)
Q1CMV6 1.29e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Nepal516)
A9R014 1.29e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIM6 1.29e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pestis
B2K3M1 1.29e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0J8 1.29e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Antiqua)
A7FME2 1.32e-48 169 33 10 369 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
O87778 1.4e-48 169 31 8 373 2 dnaJ Chaperone protein DnaJ Latilactobacillus sakei
Q8K9Y9 1.72e-48 169 32 10 368 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q493S6 1.73e-48 169 32 10 359 3 dnaJ Chaperone protein DnaJ Blochmanniella pennsylvanica (strain BPEN)
B1HUD0 1.81e-48 169 32 9 365 3 dnaJ Chaperone protein DnaJ Lysinibacillus sphaericus (strain C3-41)
Q8L397 3.18e-48 168 30 10 370 3 dnaJ Chaperone protein DnaJ Acholeplasma laidlawii
A9N8H1 4.71e-48 168 32 10 373 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KG87 5.03e-48 167 32 9 374 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain Dugway 5J108-111)
B6J7U6 5.03e-48 167 32 9 374 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain CbuK_Q154)
A9MR76 5.66e-48 167 33 10 369 3 dnaJ Chaperone protein DnaJ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8FM80 6.28e-48 168 28 9 384 3 dnaJ2 Chaperone protein DnaJ 2 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q38W94 7.55e-48 167 31 8 371 3 dnaJ Chaperone protein DnaJ Latilactobacillus sakei subsp. sakei (strain 23K)
A7Z6W0 8.92e-48 167 31 10 367 3 dnaJ Chaperone protein DnaJ Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A6T4F5 1.01e-47 167 33 8 354 3 dnaJ Chaperone protein DnaJ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q49Y21 1.06e-47 167 31 11 363 3 dnaJ Chaperone protein DnaJ Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A5UYW4 1.08e-47 167 29 8 360 3 dnaJ Chaperone protein DnaJ Roseiflexus sp. (strain RS-1)
Q7UDU1 1.29e-47 167 33 9 354 3 dnaJ Chaperone protein DnaJ Shigella flexneri
Q82EX7 1.36e-47 167 31 10 385 3 dnaJ1 Chaperone protein DnaJ 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B5Y241 1.44e-47 166 33 8 354 3 dnaJ Chaperone protein DnaJ Klebsiella pneumoniae (strain 342)
A7MIK3 1.49e-47 166 32 9 365 3 dnaJ Chaperone protein DnaJ Cronobacter sakazakii (strain ATCC BAA-894)
Q92J37 2.21e-47 166 31 10 366 3 dnaJ Chaperone protein DnaJ Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PMM6 2.21e-47 166 31 10 366 3 dnaJ Chaperone protein DnaJ Rickettsia africae (strain ESF-5)
Q1QSX1 3.31e-47 166 30 8 372 3 dnaJ Chaperone protein DnaJ Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A8F0U0 3.38e-47 166 31 10 369 3 dnaJ Chaperone protein DnaJ Rickettsia massiliae (strain Mtu5)
A8FFD1 3.66e-47 166 31 10 366 3 dnaJ Chaperone protein DnaJ Bacillus pumilus (strain SAFR-032)
O69269 4.4e-47 165 32 10 365 3 dnaJ Chaperone protein DnaJ Lysinibacillus sphaericus
Q6NEZ1 5.5e-47 165 31 11 385 3 dnaJ2 Chaperone protein DnaJ 2 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
C4K111 6.17e-47 165 31 10 366 3 dnaJ Chaperone protein DnaJ Rickettsia peacockii (strain Rustic)
Q39JC7 7.45e-47 165 32 9 378 3 dnaJ Chaperone protein DnaJ Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BYX2 9.3e-47 164 32 9 378 3 dnaJ Chaperone protein DnaJ Burkholderia orbicola (strain AU 1054)
B1JW20 9.3e-47 164 32 9 378 3 dnaJ Chaperone protein DnaJ Burkholderia orbicola (strain MC0-3)
B4EDZ1 9.3e-47 164 32 9 378 3 dnaJ Chaperone protein DnaJ Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4S9 9.3e-47 164 32 9 378 3 dnaJ Chaperone protein DnaJ Burkholderia cenocepacia (strain HI2424)
B0BWH0 9.62e-47 164 31 10 366 3 dnaJ Chaperone protein DnaJ Rickettsia rickettsii (strain Iowa)
Q7N8Y3 1.05e-46 164 33 10 359 3 dnaJ Chaperone protein DnaJ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GR21 1.05e-46 164 31 10 366 3 dnaJ Chaperone protein DnaJ Rickettsia rickettsii (strain Sheila Smith)
Q0BI17 1.12e-46 164 32 9 378 3 dnaJ Chaperone protein DnaJ Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTK1 1.12e-46 164 32 9 378 3 dnaJ Chaperone protein DnaJ Burkholderia ambifaria (strain MC40-6)
Q5QXL2 1.43e-46 164 30 7 355 3 dnaJ Chaperone protein DnaJ Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4JBS2 1.54e-46 164 32 9 378 3 dnaJ Chaperone protein DnaJ Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q65U54 1.82e-46 164 32 10 360 3 dnaJ Chaperone protein DnaJ Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C6DF09 1.85e-46 164 33 10 358 3 dnaJ Chaperone protein DnaJ Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P17631 2.67e-46 163 31 9 366 2 dnaJ Chaperone protein DnaJ Bacillus subtilis (strain 168)
Q2SYZ3 5.25e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A9IGC5 6.4e-46 162 31 6 372 3 dnaJ Chaperone protein DnaJ Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A3ND66 7.52e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 668)
A3NYX5 7.52e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 1106a)
Q63R47 7.76e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain K96243)
Q3JP12 7.76e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 1710b)
Q84BU3 8.17e-46 162 29 6 354 3 dnaJ Chaperone protein DnaJ Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A1V0U8 8.72e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain SAVP1)
Q62HD6 8.72e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain ATCC 23344)
A2S563 8.72e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain NCTC 10229)
A3MN97 8.72e-46 162 31 8 375 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain NCTC 10247)
B2VGS0 8.85e-46 162 32 10 369 3 dnaJ Chaperone protein DnaJ Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P48207 1.07e-45 161 31 11 376 3 dnaJ Chaperone protein DnaJ Francisella tularensis
Q2A327 1.07e-45 161 31 11 376 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. holarctica (strain LVS)
A1KR91 1.28e-45 161 31 10 372 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P63969 1.28e-45 161 31 10 372 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63968 1.28e-45 161 31 10 372 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9LZV9 1.28e-45 161 31 10 372 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup C (strain 053442)
A6VNB0 1.39e-45 161 32 10 362 3 dnaJ Chaperone protein DnaJ Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A4W6D6 1.41e-45 161 32 10 361 3 dnaJ Chaperone protein DnaJ Enterobacter sp. (strain 638)
Q6D0B8 1.5e-45 161 33 10 358 3 dnaJ Chaperone protein DnaJ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5NPS5 2.07e-45 161 31 8 364 3 dnaJ Chaperone protein DnaJ Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9LCQ4 2.45e-45 160 29 10 361 3 dnaJ Chaperone protein DnaJ Brevibacillus choshinensis
C3MC05 2.77e-45 160 31 9 363 3 dnaJ Chaperone protein DnaJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q46XI8 2.83e-45 160 30 6 358 3 dnaJ Chaperone protein DnaJ Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B2JGE1 3.34e-45 160 31 8 377 3 dnaJ Chaperone protein DnaJ Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8CXD3 4.38e-45 160 29 9 363 3 dnaJ Chaperone protein DnaJ Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5F5M1 4.81e-45 160 31 12 374 3 dnaJ Chaperone protein DnaJ Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9BNG6 5e-45 160 32 7 363 3 dnaJ Chaperone protein DnaJ Delftia acidovorans (strain DSM 14801 / SPH-1)
B9MJZ0 5.41e-45 160 33 12 381 3 dnaJ Chaperone protein DnaJ Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q8DWH2 6.22e-45 159 31 10 379 3 dnaJ Chaperone protein DnaJ Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B6IVA5 6.57e-45 159 31 10 364 3 dnaJ Chaperone protein DnaJ Rhodospirillum centenum (strain ATCC 51521 / SW)
Q2NVZ0 7.58e-45 159 32 10 356 3 dnaJ Chaperone protein DnaJ Sodalis glossinidius (strain morsitans)
A4IX29 8.48e-45 159 30 11 376 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain WY96-3418)
A7NS65 1.05e-44 159 30 8 360 3 dnaJ Chaperone protein DnaJ Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B8D757 1.08e-44 159 30 11 369 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
O32465 1.09e-44 159 30 11 369 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8V3 1.09e-44 159 30 11 369 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B2SXC7 1.25e-44 159 31 6 374 3 dnaJ Chaperone protein DnaJ Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q8NLY8 1.46e-44 159 27 10 388 3 dnaJ2 Chaperone protein DnaJ 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q5NSW9 1.69e-44 158 32 10 378 3 dnaJ Chaperone protein DnaJ Burkholderia multivorans (strain ATCC 17616 / 249)
Q7VQL3 1.77e-44 158 31 8 360 3 dnaJ Chaperone protein DnaJ Blochmanniella floridana
B1YKT0 2.03e-44 158 30 6 346 3 dnaJ Chaperone protein DnaJ Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A7HZ38 2.44e-44 158 32 8 366 3 dnaJ Chaperone protein DnaJ Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A2SIR5 2.48e-44 158 31 8 361 3 dnaJ Chaperone protein DnaJ Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q3K3T1 5.21e-44 157 31 9 365 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8D2Q6 5.23e-44 157 31 11 359 3 dnaJ Chaperone protein DnaJ Wigglesworthia glossinidia brevipalpis
P42381 5.57e-44 157 31 8 367 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q8E298 8.16e-44 157 31 9 365 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q5M6D0 8.41e-44 157 30 8 365 3 dnaJ Chaperone protein DnaJ Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1T7 8.41e-44 157 30 8 365 3 dnaJ Chaperone protein DnaJ Streptococcus thermophilus (strain CNRZ 1066)
Q5NFG8 9.23e-44 156 30 11 379 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GX0 9.23e-44 156 30 11 379 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain FSC 198)
B6IZJ1 9.33e-44 156 30 8 367 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain CbuG_Q212)
Q145F0 9.46e-44 157 30 6 375 3 dnaJ Chaperone protein DnaJ Paraburkholderia xenovorans (strain LB400)
Q8E7Q7 1.04e-43 156 31 9 365 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype III (strain NEM316)
Q5WV16 1.08e-43 156 30 7 366 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Lens)
Q8XW41 1.13e-43 156 29 9 379 3 dnaJ Chaperone protein DnaJ Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C1DD87 1.84e-43 156 33 9 370 3 dnaJ Chaperone protein DnaJ Laribacter hongkongensis (strain HLHK9)
P50025 2.32e-43 155 30 8 372 3 dnaJ Chaperone protein DnaJ Legionella pneumophila
Q5ZTY4 2.32e-43 155 30 8 372 3 dnaJ Chaperone protein DnaJ Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IDK7 2.32e-43 155 30 8 372 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Corby)
Q5X3M8 2.32e-43 155 30 8 372 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Paris)
Q049W7 2.44e-43 155 28 6 363 3 dnaJ Chaperone protein DnaJ Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9R3 2.77e-43 155 28 6 363 3 dnaJ Chaperone protein DnaJ Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q6A662 4.31e-43 155 29 11 373 3 dnaJ2 Chaperone protein DnaJ 2 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B3R6G6 4.54e-43 155 31 6 356 3 dnaJ Chaperone protein DnaJ Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q15UD2 4.99e-43 155 29 8 355 3 dnaJ Chaperone protein DnaJ Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B0TYF3 7.83e-43 154 29 12 376 3 dnaJ Chaperone protein DnaJ Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
C0ZB49 9.77e-43 154 29 9 350 3 dnaJ Chaperone protein DnaJ Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q5E3A8 1.15e-42 154 30 9 354 3 dnaJ Chaperone protein DnaJ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5YNI2 1.22e-42 154 28 12 384 3 dnaJ2 Chaperone protein DnaJ 2 Nocardia farcinica (strain IFM 10152)
B8I304 1.23e-42 154 31 11 373 3 dnaJ Chaperone protein DnaJ Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q73T77 1.34e-42 154 30 13 385 3 dnaJ2 Chaperone protein DnaJ 2 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q74IT7 2.04e-42 153 30 8 356 3 dnaJ Chaperone protein DnaJ Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q89AU7 2.04e-42 153 29 9 377 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B8GNX2 2.17e-42 153 32 6 355 3 dnaJ Chaperone protein DnaJ Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
P48208 2.83e-42 152 31 10 370 3 dnaJ Chaperone protein DnaJ Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8KRC9 5.03e-42 152 30 11 362 3 dnaJ Chaperone protein DnaJ Myxococcus xanthus
A3DF24 5.2e-42 152 31 12 376 3 dnaJ Chaperone protein DnaJ Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q0K758 6.16e-42 152 30 6 359 3 dnaJ Chaperone protein DnaJ Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B8F7S3 8.17e-42 151 31 8 362 3 dnaJ Chaperone protein DnaJ Glaesserella parasuis serovar 5 (strain SH0165)
Q02605 9.64e-42 151 29 13 383 3 dnaJ1 Chaperone protein DnaJ 1 Mycobacterium leprae (strain TN)
P35514 1.23e-41 151 30 7 367 3 dnaJ Chaperone protein DnaJ Lactococcus lactis subsp. lactis (strain IL1403)
Q6G553 2.02e-41 150 31 11 359 3 dnaJ Chaperone protein DnaJ Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1IF58 2.06e-41 150 30 10 373 3 dnaJ Chaperone protein DnaJ Pseudomonas entomophila (strain L48)
Q88DU3 2.88e-41 150 29 10 373 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2KDW7 4.25e-41 149 30 10 368 3 dnaJ Chaperone protein DnaJ Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9HV44 4.43e-41 149 29 7 356 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FR2 4.43e-41 149 29 7 356 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1H2 4.43e-41 149 29 7 356 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain LESB58)
A1V9Q3 6.6e-41 149 30 9 358 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain DP4)
Q725M6 6.6e-41 149 30 9 358 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A8IPT0 9.92e-41 149 29 9 365 3 dnaJ Chaperone protein DnaJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A6W2D1 1e-40 149 30 9 373 3 dnaJ Chaperone protein DnaJ Marinomonas sp. (strain MWYL1)
Q9ZDY0 1.02e-40 148 30 12 356 3 dnaJ Chaperone protein DnaJ Rickettsia prowazekii (strain Madrid E)
B1Y787 1.06e-40 149 30 5 361 3 dnaJ Chaperone protein DnaJ Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1LJ82 1.24e-40 148 30 8 359 3 dnaJ Chaperone protein DnaJ Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4WW88 1.25e-40 148 29 7 366 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A1K4C4 1.28e-40 148 30 10 379 3 dnaJ Chaperone protein DnaJ Azoarcus sp. (strain BH72)
A1VMG1 1.3e-40 148 31 10 381 3 dnaJ Chaperone protein DnaJ Polaromonas naphthalenivorans (strain CJ2)
P73097 1.36e-40 146 31 8 319 3 dnaJ2 Chaperone protein DnaJ 2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q16D44 1.69e-40 148 30 9 371 3 dnaJ Chaperone protein DnaJ Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q057X7 1.89e-40 148 28 10 373 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q128K1 1.92e-40 148 32 9 363 3 dnaJ Chaperone protein DnaJ Polaromonas sp. (strain JS666 / ATCC BAA-500)
P50027 2.1e-40 147 31 11 330 4 slr0093 DnAJ-like protein slr0093 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B9KPP3 2.22e-40 148 30 10 372 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B1J255 2.37e-40 147 28 10 366 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain W619)
A3PNM0 2.47e-40 147 30 9 369 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q2SMM7 2.58e-40 147 31 7 350 3 dnaJ Chaperone protein DnaJ Hahella chejuensis (strain KCTC 2396)
Q3IYM8 2.6e-40 147 30 9 369 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
C1DFM2 4.09e-40 147 31 10 358 3 dnaJ Chaperone protein DnaJ Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A6UEY1 4.55e-40 147 29 8 357 3 dnaJ Chaperone protein DnaJ Sinorhizobium medicae (strain WSM419)
Q3SIN3 4.8e-40 147 30 8 369 3 dnaJ Chaperone protein DnaJ Thiobacillus denitrificans (strain ATCC 25259)
O66921 6.83e-40 146 30 9 341 3 dnaJ2 Chaperone protein DnaJ 2 Aquifex aeolicus (strain VF5)
Q3AF07 7.1e-40 146 33 10 365 3 dnaJ Chaperone protein DnaJ Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B9JZ89 8.58e-40 146 29 10 367 3 dnaJ Chaperone protein DnaJ Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q5WHG0 9.48e-40 146 29 7 359 3 dnaJ Chaperone protein DnaJ Shouchella clausii (strain KSM-K16)
B0KIS4 1.23e-39 145 28 10 366 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain GB-1)
B2UBP2 1.26e-39 145 29 8 379 3 dnaJ Chaperone protein DnaJ Ralstonia pickettii (strain 12J)
A5W9A2 1.65e-39 145 28 10 366 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q5P1H7 2.18e-39 145 31 12 377 3 dnaJ2 Chaperone protein DnaJ 2 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q48E63 2.49e-39 145 29 8 356 3 dnaJ Chaperone protein DnaJ Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P22305 2.93e-39 145 29 8 362 3 dnaJ Chaperone protein DnaJ Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q92T07 2.98e-39 145 29 9 363 3 dnaJ Chaperone protein DnaJ Rhizobium meliloti (strain 1021)
Q7MN84 3.3e-39 145 29 7 361 3 dnaJ Chaperone protein DnaJ Vibrio vulnificus (strain YJ016)
Q8DF67 3.3e-39 145 29 7 361 3 dnaJ Chaperone protein DnaJ Vibrio vulnificus (strain CMCP6)
P50018 4.44e-39 144 28 10 365 2 dnaJ Chaperone protein DnaJ Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4KIH0 4.5e-39 144 29 9 359 3 dnaJ Chaperone protein DnaJ Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
O34136 4.57e-39 142 32 8 330 3 dnaJ Chaperone protein DnaJ Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP)
B3PXH2 5.72e-39 144 30 9 365 3 dnaJ Chaperone protein DnaJ Rhizobium etli (strain CIAT 652)
Q87BS9 6.8e-39 144 29 8 357 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6F5 6.8e-39 144 29 8 357 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain M23)
B2GBQ6 8.67e-39 144 27 8 369 3 dnaJ Chaperone protein DnaJ Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B0U3J7 9.5e-39 143 29 8 357 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain M12)
Q6RSN5 1.14e-38 143 29 9 366 1 dnaJ Chaperone protein DnaJ Rhizobium radiobacter
P77866 1.42e-38 143 32 9 359 3 dnaJ Chaperone protein DnaJ Aggregatibacter actinomycetemcomitans
A8GMF8 1.53e-38 142 28 7 353 3 dnaJ Chaperone protein DnaJ Rickettsia akari (strain Hartford)
A8EXP6 1.56e-38 143 30 12 359 3 dnaJ Chaperone protein DnaJ Rickettsia canadensis (strain McKiel)
Q4FNQ0 1.98e-38 142 29 11 363 3 dnaJ Chaperone protein DnaJ Pelagibacter ubique (strain HTCC1062)
Q9PB06 2.08e-38 142 29 8 357 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain 9a5c)
A1B4F0 3.27e-38 142 29 9 372 3 dnaJ Chaperone protein DnaJ Paracoccus denitrificans (strain Pd 1222)
A9KKT9 3.32e-38 142 27 10 357 3 dnaJ Chaperone protein DnaJ Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q93R26 3.85e-38 142 29 9 364 3 dnaJ Chaperone protein DnaJ Tetragenococcus halophilus
Q68XI3 3.97e-38 141 30 14 356 3 dnaJ Chaperone protein DnaJ Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q8RH03 5.6e-38 142 28 5 380 3 dnaJ Chaperone protein DnaJ Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q114R3 5.64e-38 141 28 8 374 3 dnaJ Chaperone protein DnaJ Trichodesmium erythraeum (strain IMS101)
Q4UJK6 5.66e-38 141 30 11 356 3 dnaJ Chaperone protein DnaJ Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B5ENA2 6.8e-38 141 30 11 373 3 dnaJ Chaperone protein DnaJ Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7X8 6.8e-38 141 30 11 373 3 dnaJ Chaperone protein DnaJ Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B5ZWQ1 9.19e-38 140 30 10 368 3 dnaJ Chaperone protein DnaJ Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A5EYE5 1e-37 140 31 8 362 3 dnaJ Chaperone protein DnaJ Dichelobacter nodosus (strain VCS1703A)
B8IHL2 1.03e-37 141 29 12 372 3 dnaJ Chaperone protein DnaJ Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q70WY6 1.59e-37 140 28 9 386 3 dnaJ Chaperone protein DnaJ Fusobacterium nucleatum subsp. polymorphum
A5CX57 1.91e-37 139 29 9 372 3 dnaJ Chaperone protein DnaJ Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q98DD2 2.01e-37 140 29 12 362 3 dnaJ Chaperone protein DnaJ Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q75VW3 2.05e-37 139 28 9 355 3 dnaJ Chaperone protein DnaJ Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
P95830 2.22e-37 140 28 8 371 1 dnaJ Chaperone protein DnaJ Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q1GKS4 3.26e-37 139 28 8 370 3 dnaJ Chaperone protein DnaJ Ruegeria sp. (strain TM1040)
A5WBF8 5.45e-37 139 29 9 359 3 dnaJ Chaperone protein DnaJ Psychrobacter sp. (strain PRwf-1)
B2IBR5 6.36e-37 138 28 11 369 3 dnaJ Chaperone protein DnaJ Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q11KJ5 1.15e-36 138 29 12 363 3 dnaJ Chaperone protein DnaJ Chelativorans sp. (strain BNC1)
B9MDJ8 1.44e-36 137 29 7 361 3 dnaJ Chaperone protein DnaJ Acidovorax ebreus (strain TPSY)
B0U833 1.54e-36 137 29 10 372 3 dnaJ Chaperone protein DnaJ Methylobacterium sp. (strain 4-46)
Q316U7 1.99e-36 137 27 9 362 3 dnaJ Chaperone protein DnaJ Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5LWJ5 2.55e-36 137 29 8 368 3 dnaJ Chaperone protein DnaJ Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q3IC07 3.49e-36 137 29 10 345 3 dnaJ Chaperone protein DnaJ Pseudoalteromonas translucida (strain TAC 125)
Q67S53 3.98e-36 137 30 9 360 3 dnaJ Chaperone protein DnaJ Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q1MN12 5.74e-36 136 29 9 365 3 dnaJ Chaperone protein DnaJ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6AEC0 7.77e-36 135 27 6 366 3 dnaJ Chaperone protein DnaJ Leifsonia xyli subsp. xyli (strain CTCB07)
B7VJX0 8.07e-36 135 30 10 358 3 dnaJ Chaperone protein DnaJ Vibrio atlanticus (strain LGP32)
Q2J319 8.81e-36 135 28 11 352 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain HaA2)
B9JGW2 1.01e-35 135 29 11 370 3 dnaJ Chaperone protein DnaJ Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q6G1F8 1.51e-35 135 30 12 359 3 dnaJ Chaperone protein DnaJ Bartonella quintana (strain Toulouse)
Q8NZM7 1.53e-35 135 27 6 365 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XAD7 1.53e-35 135 27 6 365 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
B4SSQ7 1.57e-35 135 29 11 359 3 dnaJ Chaperone protein DnaJ Stenotrophomonas maltophilia (strain R551-3)
Q28VY4 1.83e-35 135 28 7 367 3 dnaJ Chaperone protein DnaJ Jannaschia sp. (strain CCS1)
A1U613 2.29e-35 134 29 8 348 3 dnaJ Chaperone protein DnaJ Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q7WGI5 2.44e-35 134 28 6 374 3 dnaJ Chaperone protein DnaJ Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B2FMY6 2.46e-35 134 29 9 353 3 dnaJ Chaperone protein DnaJ Stenotrophomonas maltophilia (strain K279a)
Q7NXI1 3.06e-35 134 30 10 372 3 dnaJ Chaperone protein DnaJ Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q607A6 3.14e-35 134 30 5 349 3 dnaJ Chaperone protein DnaJ Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A6T225 3.54e-35 134 30 13 380 3 dnaJ Chaperone protein DnaJ Janthinobacterium sp. (strain Marseille)
P0C0B5 4.27e-35 134 27 6 365 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes
Q7W520 4.56e-35 134 28 6 374 3 dnaJ Chaperone protein DnaJ Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B8DQW8 4.59e-35 133 28 9 364 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q93S23 5.65e-35 132 29 10 337 3 dnaJ Chaperone protein DnaJ (Fragment) Rhizobium tropici
Q0AIY0 5.71e-35 133 29 10 371 3 dnaJ Chaperone protein DnaJ Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q7VVY3 7.64e-35 133 28 6 376 3 dnaJ Chaperone protein DnaJ Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
O67623 8.29e-35 132 26 6 353 3 dnaJ1 Chaperone protein DnaJ 1 Aquifex aeolicus (strain VF5)
Q7V3Q3 1.14e-34 132 27 7 373 3 dnaJ Chaperone protein DnaJ Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P0DA71 1.19e-34 132 27 6 365 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DA70 1.19e-34 132 27 6 365 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0B6 1.19e-34 132 27 6 365 3 dnaJ Chaperone protein DnaJ Streptococcus pyogenes serotype M1
O06431 1.23e-34 132 29 10 371 3 dnaJ Chaperone protein DnaJ Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A5CD86 1.3e-34 132 28 12 350 3 dnaJ Chaperone protein DnaJ Orientia tsutsugamushi (strain Boryong)
Q8EUM4 1.8e-34 132 27 11 355 3 dnaJ Chaperone protein DnaJ Malacoplasma penetrans (strain HF-2)
B3CVD9 1.98e-34 132 27 12 354 3 dnaJ Chaperone protein DnaJ Orientia tsutsugamushi (strain Ikeda)
Q03FR6 2.15e-34 132 29 10 362 3 dnaJ Chaperone protein DnaJ Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q4FVQ7 2.51e-34 131 29 10 362 3 dnaJ Chaperone protein DnaJ Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q8EHT6 3.15e-34 131 30 8 358 3 dnaJ Chaperone protein DnaJ Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B1KRT1 4.57e-34 131 29 8 370 3 dnaJ Chaperone protein DnaJ Shewanella woodyi (strain ATCC 51908 / MS32)
C4L424 5.16e-34 130 27 7 365 3 dnaJ Chaperone protein DnaJ Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q2KWA4 5.65e-34 130 28 7 373 3 dnaJ Chaperone protein DnaJ Bordetella avium (strain 197N)
A4XYF5 6.23e-34 130 28 10 353 3 dnaJ Chaperone protein DnaJ Pseudomonas mendocina (strain ymp)
Q1QET5 1.15e-33 130 29 9 362 3 dnaJ Chaperone protein DnaJ Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
P50026 1.32e-33 127 29 8 298 3 dnaJ Chaperone protein DnaJ Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A6VCL7 1.76e-33 129 28 8 356 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain PA7)
A6LRN5 2.4e-33 129 28 9 352 3 dnaJ Chaperone protein DnaJ Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B7KEJ8 2.51e-33 129 28 10 378 3 dnaJ Chaperone protein DnaJ Gloeothece citriformis (strain PCC 7424)
Q2GLU9 4.42e-33 128 27 12 372 3 dnaJ Chaperone protein DnaJ Anaplasma phagocytophilum (strain HZ)
P0CW06 4.82e-33 128 27 9 355 3 dnaJ Chaperone protein DnaJ Methanosarcina mazei
P0CW07 4.82e-33 128 27 9 355 3 dnaJ Chaperone protein DnaJ Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q0A7E4 5.19e-33 128 29 10 378 3 dnaJ Chaperone protein DnaJ Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B2J3J3 5.23e-33 128 27 9 377 3 dnaJ Chaperone protein DnaJ Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q82BY4 5.8e-33 128 29 9 369 3 dnaJ2 Chaperone protein DnaJ 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B0CAZ0 6.32e-33 128 28 12 375 3 dnaJ Chaperone protein DnaJ Acaryochloris marina (strain MBIC 11017)
Q52702 6.83e-33 128 27 8 368 3 dnaJ Chaperone protein DnaJ Rhodobacter capsulatus
A8LQ63 9.25e-33 127 28 10 370 3 dnaJ Chaperone protein DnaJ Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q6VAY5 1.43e-32 127 27 8 356 3 dnaJ Chaperone protein DnaJ Stutzerimonas stutzeri
Q2VYT0 1.58e-32 127 30 8 360 3 dnaJ Chaperone protein DnaJ Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
O87385 2.62e-32 126 29 10 322 3 dnaJ Chaperone protein DnaJ Vibrio harveyi
Q38813 5.34e-32 126 26 8 359 2 ATJ1 Chaperone protein dnaJ 1, mitochondrial Arabidopsis thaliana
B0S1F7 7.16e-32 125 26 8 351 3 dnaJ Chaperone protein DnaJ Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
C3LTA6 7.21e-32 125 28 11 356 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain M66-2)
O34242 7.21e-32 125 28 11 356 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F362 7.21e-32 125 28 11 356 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q0VST5 8.85e-32 125 28 8 374 3 dnaJ Chaperone protein DnaJ Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1WAR7 9.91e-32 124 29 9 362 3 dnaJ Chaperone protein DnaJ Acidovorax sp. (strain JS42)
Q9HJ83 1.17e-31 124 28 9 367 3 dnaJ Chaperone protein DnaJ Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q21CI1 1.17e-31 124 28 12 351 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain BisB18)
Q9RDD7 1.39e-31 124 29 9 369 3 dnaJ2 Chaperone protein DnaJ 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B0VA24 1.51e-31 124 28 9 366 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AYE)
A3MA88 1.51e-31 124 28 9 366 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQ00 1.51e-31 124 28 9 366 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain SDF)
B2I2G6 1.51e-31 124 28 9 366 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain ACICU)
B7I2B2 1.51e-31 124 28 9 366 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AB0057)
B7GV08 1.51e-31 124 28 9 366 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AB307-0294)
Q49762 2.75e-31 123 26 8 354 3 dnaJ2 Chaperone protein DnaJ 2 Mycobacterium leprae (strain TN)
Q8CWT2 2.76e-31 123 26 9 371 3 dnaJ Chaperone protein DnaJ Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q6MT07 4.46e-31 123 26 8 378 3 dnaJ Chaperone protein DnaJ Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P40170 6.91e-31 123 42 2 145 3 dnaJ1 Chaperone protein DnaJ 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P40170 4.12e-18 87 29 11 303 3 dnaJ1 Chaperone protein DnaJ 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P87239 7.51e-31 124 26 13 382 3 mdj1 DnaJ homolog 1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q6F6R1 9.21e-31 122 29 12 357 3 dnaJ Chaperone protein DnaJ Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q72GN6 1.27e-30 121 28 11 370 3 dnaJ Chaperone protein DnaJ Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q3J7D9 1.57e-30 121 28 8 368 3 dnaJ Chaperone protein DnaJ Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5N6M3 1.73e-30 121 27 8 370 3 dnaJ Chaperone protein DnaJ Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
A4SFR5 1.76e-30 122 27 10 377 3 dnaJ Chaperone protein DnaJ Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q5P9E0 1.77e-30 121 28 12 373 3 dnaJ Chaperone protein DnaJ Anaplasma marginale (strain St. Maries)
B9KH92 1.77e-30 121 28 12 373 3 dnaJ Chaperone protein DnaJ Anaplasma marginale (strain Florida)
Q5SLW9 2.07e-30 120 28 11 370 3 dnaJ1 Chaperone protein DnaJ 1 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q6L0S6 2.22e-30 120 28 8 346 3 dnaJ Chaperone protein DnaJ Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q83MZ4 6.27e-30 119 26 8 356 3 dnaJ Chaperone protein DnaJ Tropheryma whipplei (strain Twist)
P71500 7.25e-30 119 26 9 370 3 dnaJ Chaperone protein DnaJ Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q83NI2 1.1e-29 119 26 8 356 3 dnaJ Chaperone protein DnaJ Tropheryma whipplei (strain TW08/27)
Q044A8 1.2e-29 119 26 9 372 3 dnaJ Chaperone protein DnaJ Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A6QBG7 1.31e-29 119 27 11 385 3 dnaJ Chaperone protein DnaJ Sulfurovum sp. (strain NBC37-1)
Q9CMS2 1.55e-29 119 43 1 138 3 dnaJ Chaperone protein DnaJ Pasteurella multocida (strain Pm70)
Q9CMS2 6.15e-19 89 28 13 289 3 dnaJ Chaperone protein DnaJ Pasteurella multocida (strain Pm70)
Q87RX2 3.7e-29 118 26 10 359 3 dnaJ Chaperone protein DnaJ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1TLH8 7.22e-29 117 41 1 152 3 dnaJ Chaperone protein DnaJ Paracidovorax citrulli (strain AAC00-1)
A1TLH8 2.24e-10 64 30 3 143 3 dnaJ Chaperone protein DnaJ Paracidovorax citrulli (strain AAC00-1)
Q1H3B9 7.49e-29 117 40 3 156 3 dnaJ Chaperone protein DnaJ Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1H3B9 1.63e-12 70 47 1 76 3 dnaJ Chaperone protein DnaJ Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q7M9T3 1.13e-28 116 28 11 353 3 dnaJ Chaperone protein DnaJ Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q65H55 1.5e-28 116 35 2 162 3 dnaJ Chaperone protein DnaJ Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q65H55 2.92e-21 96 30 11 284 3 dnaJ Chaperone protein DnaJ Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3A8C3 2.18e-28 115 28 9 358 3 dnaJ Chaperone protein DnaJ Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q9KD71 4.75e-28 114 40 1 135 3 dnaJ Chaperone protein DnaJ Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KD71 1.01e-15 80 48 0 68 3 dnaJ Chaperone protein DnaJ Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4G8D1 7.81e-28 114 40 3 156 3 dnaJ Chaperone protein DnaJ Herminiimonas arsenicoxydans
A4G8D1 4.81e-12 69 27 15 305 3 dnaJ Chaperone protein DnaJ Herminiimonas arsenicoxydans
A4XKA5 8.5e-28 114 41 2 150 3 dnaJ Chaperone protein DnaJ Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A4XKA5 3.79e-18 87 27 13 309 3 dnaJ Chaperone protein DnaJ Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A7MWW1 1.94e-27 113 26 10 359 3 dnaJ Chaperone protein DnaJ Vibrio campbellii (strain ATCC BAA-1116)
B6EKA0 2.28e-27 113 38 1 152 3 dnaJ Chaperone protein DnaJ Aliivibrio salmonicida (strain LFI1238)
B6EKA0 1.53e-10 65 44 2 72 3 dnaJ Chaperone protein DnaJ Aliivibrio salmonicida (strain LFI1238)
A8FYT9 2.31e-27 113 40 3 163 3 dnaJ Chaperone protein DnaJ Shewanella sediminis (strain HAW-EB3)
A8FYT9 1.66e-11 67 34 2 140 3 dnaJ Chaperone protein DnaJ Shewanella sediminis (strain HAW-EB3)
Q0AKB3 3.12e-27 112 27 12 373 3 dnaJ Chaperone protein DnaJ Maricaulis maris (strain MCS10)
P9WNV9 5.27e-27 112 38 2 147 1 dnaJ1 Chaperone protein DnaJ 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNV9 5.83e-11 66 26 11 299 1 dnaJ1 Chaperone protein DnaJ 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNV8 5.27e-27 112 38 2 147 3 dnaJ1 Chaperone protein DnaJ 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WNV8 5.83e-11 66 26 11 299 3 dnaJ1 Chaperone protein DnaJ 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A549 5.27e-27 112 38 2 147 3 dnaJ1 Chaperone protein DnaJ 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0A549 5.83e-11 66 26 11 299 3 dnaJ1 Chaperone protein DnaJ 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8FNF5 5.51e-27 112 26 8 361 3 dnaJ1 Chaperone protein DnaJ 1 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1AW21 5.68e-27 111 39 2 146 3 dnaJ Chaperone protein DnaJ Ruthia magnifica subsp. Calyptogena magnifica
A1AW21 1e-13 74 26 10 289 3 dnaJ Chaperone protein DnaJ Ruthia magnifica subsp. Calyptogena magnifica
Q24331 5.77e-27 113 25 11 381 2 l(2)tid Protein tumorous imaginal discs, mitochondrial Drosophila virilis
B0SRF0 6.4e-27 111 28 11 359 3 dnaJ Chaperone protein DnaJ Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SHT0 6.4e-27 111 28 11 359 3 dnaJ Chaperone protein DnaJ Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q8GWW8 9.38e-27 112 24 10 369 2 GFA2 Chaperone protein dnaJ GFA2, mitochondrial Arabidopsis thaliana
A0LJ41 1.02e-26 111 27 13 378 3 dnaJ Chaperone protein DnaJ Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B8HLD2 1.12e-26 111 27 8 365 3 dnaJ Chaperone protein DnaJ Cyanothece sp. (strain PCC 7425 / ATCC 29141)
O27352 1.17e-26 111 31 14 317 3 dnaJ Chaperone protein DnaJ Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O27352 3.59e-25 107 36 1 155 3 dnaJ Chaperone protein DnaJ Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A1S8K6 1.29e-26 110 42 3 151 3 dnaJ Chaperone protein DnaJ Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A1S8K6 4.6e-11 66 43 1 76 3 dnaJ Chaperone protein DnaJ Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8CXL0 1.44e-26 110 36 3 160 3 dnaJ Chaperone protein DnaJ Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B8CXL0 6.19e-19 89 48 2 96 3 dnaJ Chaperone protein DnaJ Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q2JH49 1.54e-26 110 32 11 281 3 dnaJ Chaperone protein DnaJ Synechococcus sp. (strain JA-2-3B'a(2-13))
Q2JH49 3.17e-20 93 33 2 162 3 dnaJ Chaperone protein DnaJ Synechococcus sp. (strain JA-2-3B'a(2-13))
B8CKF4 1.99e-26 110 40 3 163 3 dnaJ Chaperone protein DnaJ Shewanella piezotolerans (strain WP3 / JCM 13877)
B8CKF4 3.52e-11 67 32 2 140 3 dnaJ Chaperone protein DnaJ Shewanella piezotolerans (strain WP3 / JCM 13877)
Q6LUA6 2.65e-26 110 38 1 152 3 dnaJ Chaperone protein DnaJ Photobacterium profundum (strain SS9)
Q6LUA6 2.86e-14 76 37 3 107 3 dnaJ Chaperone protein DnaJ Photobacterium profundum (strain SS9)
Q2GI75 2.79e-26 110 28 12 370 3 dnaJ Chaperone protein DnaJ Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q12Q07 3.41e-26 109 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q12Q07 1.28e-10 65 43 1 76 3 dnaJ Chaperone protein DnaJ Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0BTI6 3.45e-26 109 38 1 154 3 dnaJ Chaperone protein DnaJ Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B0BTI6 4.26e-17 84 29 11 286 3 dnaJ Chaperone protein DnaJ Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A8H759 3.51e-26 109 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8H759 9.73e-12 68 34 2 108 3 dnaJ Chaperone protein DnaJ Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3N3J9 3.52e-26 109 38 1 154 3 dnaJ Chaperone protein DnaJ Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A3N3J9 1.64e-16 82 28 11 286 3 dnaJ Chaperone protein DnaJ Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0TQC1 3.72e-26 109 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella halifaxensis (strain HAW-EB4)
B0TQC1 7.46e-10 62 40 1 76 3 dnaJ Chaperone protein DnaJ Shewanella halifaxensis (strain HAW-EB4)
A6Q486 4.46e-26 109 27 9 358 3 dnaJ Chaperone protein DnaJ Nitratiruptor sp. (strain SB155-2)
Q182E7 4.49e-26 109 36 1 151 3 dnaJ Chaperone protein DnaJ Clostridioides difficile (strain 630)
Q182E7 1.3e-11 68 45 1 66 3 dnaJ Chaperone protein DnaJ Clostridioides difficile (strain 630)
P43735 4.65e-26 109 38 1 152 3 dnaJ Chaperone protein DnaJ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P43735 1.84e-13 73 48 2 72 3 dnaJ Chaperone protein DnaJ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B1ZGR2 6.63e-26 108 37 3 152 3 dnaJ Chaperone protein DnaJ Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B7KSZ5 6.8e-26 108 37 3 152 3 dnaJ Chaperone protein DnaJ Methylorubrum extorquens (strain CM4 / NCIMB 13688)
C3K274 7.27e-26 108 39 1 149 3 dnaJ Chaperone protein DnaJ Pseudomonas fluorescens (strain SBW25)
C3K274 4.81e-12 69 28 15 305 3 dnaJ Chaperone protein DnaJ Pseudomonas fluorescens (strain SBW25)
Q9PQ82 7.9e-26 108 25 8 346 3 dnaJ Chaperone protein DnaJ Ureaplasma parvum serovar 3 (strain ATCC 700970)
A9W6R8 1.15e-25 108 37 3 152 3 dnaJ Chaperone protein DnaJ Methylorubrum extorquens (strain PA1)
Q2JW78 1.24e-25 108 32 12 303 3 dnaJ Chaperone protein DnaJ Synechococcus sp. (strain JA-3-3Ab)
Q2JW78 5.2e-19 90 34 2 162 3 dnaJ Chaperone protein DnaJ Synechococcus sp. (strain JA-3-3Ab)
Q0HY10 1.46e-25 108 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain MR-7)
Q0HY10 2.7e-10 64 42 1 76 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain MR-7)
Q0HLM9 1.46e-25 108 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain MR-4)
Q0HLM9 2.7e-10 64 42 1 76 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain MR-4)
A0KTS6 1.58e-25 108 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain ANA-3)
A0KTS6 2.61e-10 64 42 1 76 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain ANA-3)
Q31HA6 1.67e-25 108 38 1 152 3 dnaJ Chaperone protein DnaJ Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q31HA6 5.19e-11 66 46 2 71 3 dnaJ Chaperone protein DnaJ Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B1LZ52 1.69e-25 107 28 11 357 3 dnaJ Chaperone protein DnaJ Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A6WRU8 2.11e-25 107 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS185)
A6WRU8 9.3e-11 65 43 1 76 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS185)
A3D7T3 2.11e-25 107 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS155 / ATCC BAA-1091)
A3D7T3 9.3e-11 65 43 1 76 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4S2 2.11e-25 107 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS223)
B8E4S2 9.3e-11 65 43 1 76 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS223)
Q086J2 2.13e-25 107 41 3 151 3 dnaJ Chaperone protein DnaJ Shewanella frigidimarina (strain NCIMB 400)
Q086J2 1.32e-10 65 43 1 76 3 dnaJ Chaperone protein DnaJ Shewanella frigidimarina (strain NCIMB 400)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03925
Feature type CDS
Gene cbpA
Product curved DNA-binding protein
Location 885114 - 886058 (strand: 1)
Length 945 (nucleotides) / 314 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_182
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00226 DnaJ domain
PF01556 DnaJ C terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0484 Posttranslational modification, protein turnover, chaperones (O) O DnaJ-class molecular chaperone with C-terminal Zn finger domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05516 curved DNA-binding protein - -

Protein Sequence

MELKDYYAIMGVKPTDDMKTIKTAYRRLAKKYHPDVSKEPDAEERFKEIAQAWEILGDEQRRAEYDELWAHRNDPKFKQFTQHNNSHSNQQSFSQEDFDDLYASFFGQGSPFEGRHSRQAPRQRGQDLEIELPVFLEEAQEEHKRTISYHLPVYNVFGMIEKEIPKTLNVKIPAGVVDGQRIRLKGQGTAGENGGENGDLWLTIRIAPHPLFDVKGHDLEIVVPIAPWEAALGTKIAIPTLKDKILLTIPPASQAGQRLRIKGKGLVSKQKSGDLYAILKVVMPPKVDEKTHSLWQQLAEAQADYNPRKNWENK

Flanking regions ( +/- flanking 50bp)

TAATCTATAGATGTAGGGTATTTAATGTTTAACATAATCGAGATATCACTATGGAATTAAAGGATTATTACGCCATTATGGGGGTAAAACCCACTGATGACATGAAAACAATTAAAACTGCTTATCGCCGTTTAGCGAAAAAATATCACCCAGATGTAAGTAAAGAGCCAGATGCTGAGGAGCGTTTTAAAGAAATAGCGCAAGCTTGGGAAATTCTTGGTGATGAACAGCGTAGAGCTGAATATGACGAACTTTGGGCTCACCGCAATGATCCGAAATTTAAACAATTTACACAGCACAACAATTCACATTCAAACCAACAAAGTTTTAGTCAGGAAGATTTTGACGATCTTTATGCTTCTTTCTTTGGTCAAGGTTCACCTTTTGAAGGGCGCCATTCACGTCAAGCACCTAGACAACGTGGACAAGATCTAGAAATTGAATTACCGGTTTTTCTTGAAGAAGCACAAGAAGAGCATAAGCGTACCATTAGCTATCATTTACCGGTTTATAATGTCTTTGGCATGATAGAGAAAGAAATTCCTAAGACCTTGAATGTCAAAATTCCTGCCGGTGTTGTTGATGGACAACGTATTCGTTTAAAAGGCCAAGGTACTGCTGGGGAGAATGGCGGAGAAAATGGTGATTTATGGCTAACTATCCGTATTGCACCTCATCCATTATTTGATGTAAAAGGGCATGATCTTGAAATTGTGGTTCCTATTGCACCTTGGGAAGCCGCATTAGGTACTAAAATTGCTATTCCTACACTTAAAGATAAAATTTTACTTACTATTCCTCCCGCTAGTCAGGCAGGTCAACGCCTGAGAATTAAAGGAAAAGGCTTAGTAAGCAAGCAAAAAAGTGGTGATCTCTATGCCATTTTGAAAGTCGTCATGCCACCTAAAGTGGATGAAAAAACACATTCATTATGGCAACAACTCGCCGAAGCCCAAGCCGATTATAATCCACGTAAAAACTGGGAGAATAAATAATGGCACAATTAACAACAATATTTACTATGACTGAGCTTTGTCATCATACT