Homologs in group_171

Help

8 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06485 FBDBKF_06485 82.5 Morganella morganii S1 dnaJ molecular chaperone DnaJ
EHELCC_09530 EHELCC_09530 82.5 Morganella morganii S2 dnaJ molecular chaperone DnaJ
NLDBIP_09910 NLDBIP_09910 82.5 Morganella morganii S4 dnaJ molecular chaperone DnaJ
LHKJJB_07845 LHKJJB_07845 82.5 Morganella morganii S3 dnaJ molecular chaperone DnaJ
HKOGLL_07395 HKOGLL_07395 82.5 Morganella morganii S5 dnaJ molecular chaperone DnaJ
F4V73_RS15445 F4V73_RS15445 81.2 Morganella psychrotolerans dnaJ molecular chaperone DnaJ
PMI_RS03925 PMI_RS03925 40.4 Proteus mirabilis HI4320 cbpA curved DNA-binding protein
PMI_RS18735 PMI_RS18735 31.9 Proteus mirabilis HI4320 - J domain-containing protein

Distribution of the homologs in the orthogroup group_171

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_171

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2V6 0.0 772 100 0 378 3 dnaJ Chaperone protein DnaJ Proteus mirabilis (strain HI4320)
Q7N8Y3 0.0 637 82 1 378 3 dnaJ Chaperone protein DnaJ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VGS0 0.0 629 82 1 380 3 dnaJ Chaperone protein DnaJ Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q3Z600 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Shigella sonnei (strain Ss046)
B7LVP7 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGI7 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain UTI89 / UPEC)
B1LFU5 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain SMS-3-5 / SECEC)
B6HZ11 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain SE11)
B7N7N9 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IRF9 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FLC5 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZVV8 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O9:H4 (strain HS)
B7M0B1 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O8 (strain IAI1)
B7MNM2 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O81 (strain ED1a)
B7NHB7 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YYA8 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA65 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O157:H7
B7L4D9 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain 55989 / EAEC)
B7MAD6 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UI60 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHA5 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MR76 0.0 619 81 1 378 3 dnaJ Chaperone protein DnaJ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BLH9 0.0 619 80 1 378 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi A (strain AKU_12601)
Q5PDJ4 0.0 619 80 1 378 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0T8H5 0.0 618 81 1 378 3 dnaJ Chaperone protein DnaJ Shigella flexneri serotype 5b (strain 8401)
Q326K6 0.0 618 81 1 378 3 dnaJ Chaperone protein DnaJ Shigella boydii serotype 4 (strain Sb227)
B2U233 0.0 618 81 1 378 3 dnaJ Chaperone protein DnaJ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q32KA4 0.0 618 81 1 378 3 dnaJ Chaperone protein DnaJ Shigella dysenteriae serotype 1 (strain Sd197)
P0A1G7 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1G8 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella typhi
B4TVZ6 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella schwarzengrund (strain CVM19633)
C0Q4F4 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi C (strain RKS4594)
A9MXI3 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T6D7 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella newport (strain SL254)
B4TIB5 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella heidelberg (strain SL476)
B5RF09 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5I3 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella enteritidis PT4 (strain P125109)
B5FHA7 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella dublin (strain CT_02021853)
Q57TP2 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella choleraesuis (strain SC-B67)
B5F6Y9 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Salmonella agona (strain SL483)
B1JL03 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66ES9 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQF8 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pestis (strain Pestoides F)
Q1CMV6 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Nepal516)
A9R014 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIM6 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pestis
B2K3M1 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0J8 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pestis bv. Antiqua (strain Antiqua)
A7FME2 0.0 617 81 1 379 3 dnaJ Chaperone protein DnaJ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P08622 0.0 617 80 1 378 1 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12)
B1XBE0 0.0 617 80 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12 / DH10B)
C5B7L8 0.0 616 80 1 378 3 dnaJ Chaperone protein DnaJ Edwardsiella ictaluri (strain 93-146)
A6T4F5 0.0 615 80 1 378 3 dnaJ Chaperone protein DnaJ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C4ZPU1 0.0 615 80 1 378 3 dnaJ Chaperone protein DnaJ Escherichia coli (strain K12 / MC4100 / BW2952)
B5Y241 0.0 615 80 1 378 3 dnaJ Chaperone protein DnaJ Klebsiella pneumoniae (strain 342)
A1JJD6 0.0 614 81 2 378 3 dnaJ Chaperone protein DnaJ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7UDU1 0.0 607 79 1 378 3 dnaJ Chaperone protein DnaJ Shigella flexneri
A4W6D6 0.0 605 78 1 382 3 dnaJ Chaperone protein DnaJ Enterobacter sp. (strain 638)
C6DF09 0.0 603 79 2 379 3 dnaJ Chaperone protein DnaJ Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8G9K9 0.0 601 79 3 378 3 dnaJ Chaperone protein DnaJ Serratia proteamaculans (strain 568)
Q6D0B8 0.0 597 78 2 380 3 dnaJ Chaperone protein DnaJ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NVZ0 0.0 596 78 2 378 3 dnaJ Chaperone protein DnaJ Sodalis glossinidius (strain morsitans)
A7MIK3 0.0 583 77 2 380 3 dnaJ Chaperone protein DnaJ Cronobacter sakazakii (strain ATCC BAA-894)
Q493S6 0.0 582 73 2 378 3 dnaJ Chaperone protein DnaJ Blochmanniella pennsylvanica (strain BPEN)
B8D757 0.0 563 69 1 378 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
O32465 0.0 563 69 1 378 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8V3 0.0 563 69 1 378 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C4L8Y4 0.0 548 70 1 377 3 dnaJ Chaperone protein DnaJ Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8K9Y9 0.0 545 68 2 379 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q7MN84 0.0 541 72 1 380 3 dnaJ Chaperone protein DnaJ Vibrio vulnificus (strain YJ016)
Q8DF67 0.0 541 72 1 380 3 dnaJ Chaperone protein DnaJ Vibrio vulnificus (strain CMCP6)
A8FYT9 0.0 541 70 2 380 3 dnaJ Chaperone protein DnaJ Shewanella sediminis (strain HAW-EB3)
Q6LUA6 0.0 541 71 3 381 3 dnaJ Chaperone protein DnaJ Photobacterium profundum (strain SS9)
B6EKA0 0.0 539 71 1 380 3 dnaJ Chaperone protein DnaJ Aliivibrio salmonicida (strain LFI1238)
Q87RX2 0.0 537 72 1 380 3 dnaJ Chaperone protein DnaJ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EHT6 0.0 536 70 3 380 3 dnaJ Chaperone protein DnaJ Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5E3A8 0.0 536 70 2 380 3 dnaJ Chaperone protein DnaJ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8D2Q6 0.0 536 67 2 377 3 dnaJ Chaperone protein DnaJ Wigglesworthia glossinidia brevipalpis
A8H759 0.0 536 69 3 379 3 dnaJ Chaperone protein DnaJ Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B1KRT1 0.0 535 69 2 380 3 dnaJ Chaperone protein DnaJ Shewanella woodyi (strain ATCC 51908 / MS32)
A6WRU8 0.0 535 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS185)
A3D7T3 0.0 535 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4S2 0.0 535 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS223)
Q9CMS2 0.0 535 71 2 378 3 dnaJ Chaperone protein DnaJ Pasteurella multocida (strain Pm70)
Q15UD2 0.0 535 70 3 381 3 dnaJ Chaperone protein DnaJ Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A9L0R7 0.0 533 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella baltica (strain OS195)
A1RGN2 0.0 533 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain W3-18-1)
C3LTA6 0.0 533 70 2 380 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain M66-2)
O34242 0.0 533 70 2 380 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F362 0.0 533 70 2 380 3 dnaJ Chaperone protein DnaJ Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A0KTS6 0.0 532 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain ANA-3)
A4Y9Q2 0.0 532 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B8CKF4 0.0 530 69 3 380 3 dnaJ Chaperone protein DnaJ Shewanella piezotolerans (strain WP3 / JCM 13877)
Q0HY10 0.0 530 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain MR-7)
Q0HLM9 0.0 530 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella sp. (strain MR-4)
A7MWW1 0.0 529 72 1 380 3 dnaJ Chaperone protein DnaJ Vibrio campbellii (strain ATCC BAA-1116)
Q7VQL3 0.0 528 69 3 379 3 dnaJ Chaperone protein DnaJ Blochmanniella floridana
B0TQC1 0.0 525 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella halifaxensis (strain HAW-EB4)
Q086J2 0.0 524 69 3 380 3 dnaJ Chaperone protein DnaJ Shewanella frigidimarina (strain NCIMB 400)
Q89AU7 0.0 523 64 2 383 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A3QGW1 0.0 521 69 3 379 3 dnaJ Chaperone protein DnaJ Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q4QJW5 0.0 518 68 0 378 3 dnaJ Chaperone protein DnaJ Haemophilus influenzae (strain 86-028NP)
Q5QXL2 0.0 516 68 3 382 3 dnaJ Chaperone protein DnaJ Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A0KMI5 0.0 514 72 1 379 3 dnaJ Chaperone protein DnaJ Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1S8K6 0.0 513 70 3 379 3 dnaJ Chaperone protein DnaJ Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q65U54 0.0 512 67 1 378 3 dnaJ Chaperone protein DnaJ Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q12Q07 0.0 510 68 2 378 3 dnaJ Chaperone protein DnaJ Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B7VJX0 1.22e-180 509 70 1 381 3 dnaJ Chaperone protein DnaJ Vibrio atlanticus (strain LGP32)
Q3IC07 3.37e-180 508 69 3 381 3 dnaJ Chaperone protein DnaJ Pseudoalteromonas translucida (strain TAC 125)
C4K3I5 1.71e-177 501 63 4 377 3 dnaJ Chaperone protein DnaJ Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A1STE5 3.29e-177 500 67 3 382 3 dnaJ Chaperone protein DnaJ Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A4SQ24 3.83e-177 500 71 1 380 3 dnaJ Chaperone protein DnaJ Aeromonas salmonicida (strain A449)
A6VNB0 7.9e-177 499 66 2 379 3 dnaJ Chaperone protein DnaJ Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
O87385 1.21e-176 499 69 4 385 3 dnaJ Chaperone protein DnaJ Vibrio harveyi
P77866 3.61e-175 495 67 3 379 3 dnaJ Chaperone protein DnaJ Aggregatibacter actinomycetemcomitans
Q0I3V1 4.59e-172 487 64 4 378 3 dnaJ Chaperone protein DnaJ Histophilus somni (strain 129Pt)
B0UWR3 1.95e-171 485 64 4 378 3 dnaJ Chaperone protein DnaJ Histophilus somni (strain 2336)
B0BTI6 2.66e-169 480 65 2 381 3 dnaJ Chaperone protein DnaJ Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N3J9 2.9e-169 480 65 2 381 3 dnaJ Chaperone protein DnaJ Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q88DU3 3.68e-169 479 64 3 379 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B8GNX2 4.98e-169 479 63 3 377 3 dnaJ Chaperone protein DnaJ Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q057X7 5.65e-169 480 56 3 389 3 dnaJ Chaperone protein DnaJ Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q2SMM7 8.28e-169 479 64 3 377 3 dnaJ Chaperone protein DnaJ Hahella chejuensis (strain KCTC 2396)
Q1IF58 9.03e-169 479 64 3 379 3 dnaJ Chaperone protein DnaJ Pseudomonas entomophila (strain L48)
B8F7S3 9.1e-169 479 65 2 380 3 dnaJ Chaperone protein DnaJ Glaesserella parasuis serovar 5 (strain SH0165)
P48208 3.72e-168 477 64 2 379 3 dnaJ Chaperone protein DnaJ Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q47XI7 1.39e-167 476 66 2 377 3 dnaJ Chaperone protein DnaJ Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q6VAY5 2.49e-167 475 65 2 378 3 dnaJ Chaperone protein DnaJ Stutzerimonas stutzeri
B0KIS4 5.5e-167 474 63 3 378 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain GB-1)
Q9HV44 6.53e-167 474 64 3 380 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FR2 6.53e-167 474 64 3 380 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1H2 6.53e-167 474 64 3 380 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain LESB58)
A5UF67 7.14e-167 474 67 1 379 3 dnaJ Chaperone protein DnaJ Haemophilus influenzae (strain PittGG)
C1DFM2 7.17e-167 474 64 3 378 3 dnaJ Chaperone protein DnaJ Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A5W9A2 9.19e-167 474 63 3 378 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P43735 1.15e-166 474 67 1 379 3 dnaJ Chaperone protein DnaJ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B1J255 1.55e-166 473 63 3 378 3 dnaJ Chaperone protein DnaJ Pseudomonas putida (strain W619)
Q8L3D3 4.03e-166 472 65 2 378 3 dnaJ Chaperone protein DnaJ Colwellia maris
A6VCL7 6.88e-165 469 64 3 380 3 dnaJ Chaperone protein DnaJ Pseudomonas aeruginosa (strain PA7)
Q1QSX1 1.05e-164 469 63 3 380 3 dnaJ Chaperone protein DnaJ Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VST5 4.45e-164 467 62 3 377 3 dnaJ Chaperone protein DnaJ Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1U613 6.56e-164 466 63 3 378 3 dnaJ Chaperone protein DnaJ Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C3K274 9.21e-164 466 63 3 378 3 dnaJ Chaperone protein DnaJ Pseudomonas fluorescens (strain SBW25)
Q4KIH0 2.66e-163 465 63 3 378 3 dnaJ Chaperone protein DnaJ Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4XYF5 4.46e-163 464 64 3 378 3 dnaJ Chaperone protein DnaJ Pseudomonas mendocina (strain ymp)
Q48E63 1.01e-161 461 63 3 382 3 dnaJ Chaperone protein DnaJ Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C1DD87 1.7e-161 461 60 2 379 3 dnaJ Chaperone protein DnaJ Laribacter hongkongensis (strain HLHK9)
Q5WV16 5.11e-161 459 59 3 379 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Lens)
P50025 6.29e-161 459 59 3 379 3 dnaJ Chaperone protein DnaJ Legionella pneumophila
Q5ZTY4 6.29e-161 459 59 3 379 3 dnaJ Chaperone protein DnaJ Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IDK7 6.29e-161 459 59 3 379 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Corby)
Q5X3M8 6.29e-161 459 59 3 379 3 dnaJ Chaperone protein DnaJ Legionella pneumophila (strain Paris)
Q5P1H7 4.57e-160 457 57 3 377 3 dnaJ2 Chaperone protein DnaJ 2 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q4ZNP8 5.14e-160 457 63 3 382 3 dnaJ Chaperone protein DnaJ Pseudomonas syringae pv. syringae (strain B728a)
Q21H37 9.66e-160 456 63 3 378 3 dnaJ Chaperone protein DnaJ Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9PB06 2.14e-159 455 57 3 377 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain 9a5c)
A9KG87 5.94e-159 454 60 4 375 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain Dugway 5J108-111)
B6J7U6 5.94e-159 454 60 4 375 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain CbuK_Q154)
A2SIR5 7.73e-159 454 57 7 383 3 dnaJ Chaperone protein DnaJ Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
C5BQ32 4.17e-158 452 60 3 379 3 dnaJ Chaperone protein DnaJ Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q87BS9 4.18e-158 451 57 3 377 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6F5 4.18e-158 451 57 3 377 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain M23)
A6W2D1 4.58e-158 451 62 3 379 3 dnaJ Chaperone protein DnaJ Marinomonas sp. (strain MWYL1)
B0U3J7 5.44e-158 451 57 3 377 3 dnaJ Chaperone protein DnaJ Xylella fastidiosa (strain M12)
B6IZJ1 1.7e-157 450 60 5 375 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain CbuG_Q212)
P42381 2.57e-157 449 60 5 375 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q87WP1 1.1e-156 448 63 3 382 3 dnaJ Chaperone protein DnaJ Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A9N8H1 1.14e-156 448 60 5 375 3 dnaJ Chaperone protein DnaJ Coxiella burnetii (strain RSA 331 / Henzerling II)
B1Y787 2.15e-156 447 58 5 389 3 dnaJ Chaperone protein DnaJ Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1K4C4 3.67e-156 447 58 3 376 3 dnaJ Chaperone protein DnaJ Azoarcus sp. (strain BH72)
B4SSQ7 1.06e-155 446 58 3 379 3 dnaJ Chaperone protein DnaJ Stenotrophomonas maltophilia (strain R551-3)
Q1H3B9 1.15e-155 445 59 1 373 3 dnaJ Chaperone protein DnaJ Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3SIN3 3.58e-155 444 60 4 375 3 dnaJ Chaperone protein DnaJ Thiobacillus denitrificans (strain ATCC 25259)
Q8XW41 6.78e-155 444 58 3 379 3 dnaJ Chaperone protein DnaJ Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2FMY6 2.23e-154 442 58 3 378 3 dnaJ Chaperone protein DnaJ Stenotrophomonas maltophilia (strain K279a)
B9MDJ8 3.22e-153 439 59 4 378 3 dnaJ Chaperone protein DnaJ Acidovorax ebreus (strain TPSY)
A1WAR7 6.54e-153 439 59 4 378 3 dnaJ Chaperone protein DnaJ Acidovorax sp. (strain JS42)
Q9ZFC5 3.12e-152 437 56 4 375 3 dnaJ Chaperone protein DnaJ Methylovorus sp. (strain SS1 / DSM 11726)
Q0AIY0 2.56e-151 434 56 4 378 3 dnaJ Chaperone protein DnaJ Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A5EYE5 2.7e-151 434 56 4 379 3 dnaJ Chaperone protein DnaJ Dichelobacter nodosus (strain VCS1703A)
Q0A7E4 5.18e-151 434 60 3 382 3 dnaJ Chaperone protein DnaJ Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q46XI8 6.12e-151 434 56 3 380 3 dnaJ Chaperone protein DnaJ Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3J7D9 1.26e-150 433 60 3 380 3 dnaJ Chaperone protein DnaJ Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
O06431 1.27e-150 432 56 4 376 3 dnaJ Chaperone protein DnaJ Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7NXI1 1.59e-150 432 57 3 376 3 dnaJ Chaperone protein DnaJ Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B2SXC7 1.67e-150 432 55 3 383 3 dnaJ Chaperone protein DnaJ Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q5NSW9 2.11e-150 432 55 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia multivorans (strain ATCC 17616 / 249)
B3R6G6 2.12e-150 432 56 3 378 3 dnaJ Chaperone protein DnaJ Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q607A6 3.5e-150 432 62 3 377 3 dnaJ Chaperone protein DnaJ Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q145F0 7.98e-150 431 55 3 384 3 dnaJ Chaperone protein DnaJ Paraburkholderia xenovorans (strain LB400)
A9BNG6 8.71e-150 431 57 4 380 3 dnaJ Chaperone protein DnaJ Delftia acidovorans (strain DSM 14801 / SPH-1)
Q2KWA4 1.04e-149 430 56 1 373 3 dnaJ Chaperone protein DnaJ Bordetella avium (strain 197N)
A1KR91 1.13e-149 430 59 2 375 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P63969 1.13e-149 430 59 2 375 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63968 1.13e-149 430 59 2 375 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9LZV9 1.13e-149 430 59 2 375 3 dnaJ Chaperone protein DnaJ Neisseria meningitidis serogroup C (strain 053442)
O52065 1.45e-149 430 62 2 381 3 dnaJ Chaperone protein DnaJ Mannheimia haemolytica
Q1BYX2 2.17e-149 430 55 3 382 3 dnaJ Chaperone protein DnaJ Burkholderia orbicola (strain AU 1054)
B1JW20 2.17e-149 430 55 3 382 3 dnaJ Chaperone protein DnaJ Burkholderia orbicola (strain MC0-3)
B4EDZ1 2.17e-149 430 55 3 382 3 dnaJ Chaperone protein DnaJ Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4S9 2.17e-149 430 55 3 382 3 dnaJ Chaperone protein DnaJ Burkholderia cenocepacia (strain HI2424)
Q39JC7 2.62e-149 429 55 3 382 3 dnaJ Chaperone protein DnaJ Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A4JBS2 3.4e-149 429 55 3 382 3 dnaJ Chaperone protein DnaJ Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9IGC5 3.41e-149 429 56 3 376 3 dnaJ Chaperone protein DnaJ Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q0BI17 6.76e-149 428 56 3 382 3 dnaJ Chaperone protein DnaJ Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTK1 6.76e-149 428 56 3 382 3 dnaJ Chaperone protein DnaJ Burkholderia ambifaria (strain MC40-6)
Q5H185 8.38e-149 428 58 3 378 3 dnaJ Chaperone protein DnaJ Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQU3 8.38e-149 428 58 3 378 3 dnaJ Chaperone protein DnaJ Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P458 8.38e-149 428 58 3 378 3 dnaJ Chaperone protein DnaJ Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7WGI5 1.05e-148 428 56 3 376 3 dnaJ Chaperone protein DnaJ Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B0RVU1 1.28e-148 427 58 3 378 3 dnaJ Chaperone protein DnaJ Xanthomonas campestris pv. campestris (strain B100)
Q8PAK8 1.34e-148 427 58 3 378 3 dnaJ Chaperone protein DnaJ Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UT12 1.34e-148 427 58 3 378 3 dnaJ Chaperone protein DnaJ Xanthomonas campestris pv. campestris (strain 8004)
Q7W520 1.45e-148 427 56 3 377 3 dnaJ Chaperone protein DnaJ Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A3ND66 2.05e-148 427 55 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 668)
A3NYX5 2.05e-148 427 55 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 1106a)
A5CX57 2.91e-148 426 56 4 375 3 dnaJ Chaperone protein DnaJ Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q3BVB7 5.18e-148 426 59 3 378 3 dnaJ Chaperone protein DnaJ Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PMA9 6.31e-148 426 59 3 378 3 dnaJ Chaperone protein DnaJ Xanthomonas axonopodis pv. citri (strain 306)
Q63R47 6.68e-148 426 55 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain K96243)
Q3JP12 6.68e-148 426 55 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia pseudomallei (strain 1710b)
Q0K758 6.96e-148 426 56 4 382 3 dnaJ Chaperone protein DnaJ Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P48207 1.07e-147 425 55 4 379 3 dnaJ Chaperone protein DnaJ Francisella tularensis
Q2A327 1.07e-147 425 55 4 379 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. holarctica (strain LVS)
B2JGE1 1.44e-147 425 54 3 381 3 dnaJ Chaperone protein DnaJ Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1V0U8 1.5e-147 425 54 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain SAVP1)
Q62HD6 1.5e-147 425 54 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain ATCC 23344)
A2S563 1.5e-147 425 54 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain NCTC 10229)
A3MN97 1.5e-147 425 54 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia mallei (strain NCTC 10247)
Q2SYZ3 2.37e-147 424 54 3 380 3 dnaJ Chaperone protein DnaJ Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q7VVY3 5.4e-147 424 55 3 385 3 dnaJ Chaperone protein DnaJ Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q5F5M1 6.79e-147 423 58 2 375 3 dnaJ Chaperone protein DnaJ Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A4IX29 1.75e-146 422 54 4 379 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain WY96-3418)
B2UBP2 3.08e-146 422 56 3 381 3 dnaJ Chaperone protein DnaJ Ralstonia pickettii (strain 12J)
Q1LJ82 3.57e-146 422 57 2 379 3 dnaJ Chaperone protein DnaJ Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q6RSN5 1.24e-145 420 56 4 382 1 dnaJ Chaperone protein DnaJ Rhizobium radiobacter
P50018 7.9e-145 418 56 4 380 2 dnaJ Chaperone protein DnaJ Agrobacterium fabrum (strain C58 / ATCC 33970)
Q128K1 1.09e-144 418 55 4 380 3 dnaJ Chaperone protein DnaJ Polaromonas sp. (strain JS666 / ATCC BAA-500)
C3MC05 1.8e-143 415 54 5 384 3 dnaJ Chaperone protein DnaJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A1VMG1 2.53e-143 414 55 4 381 3 dnaJ Chaperone protein DnaJ Polaromonas naphthalenivorans (strain CJ2)
A1TLH8 3e-143 414 57 3 378 3 dnaJ Chaperone protein DnaJ Paracidovorax citrulli (strain AAC00-1)
A6T225 3.44e-143 414 55 3 376 3 dnaJ Chaperone protein DnaJ Janthinobacterium sp. (strain Marseille)
A4G8D1 3.63e-143 414 56 3 376 3 dnaJ Chaperone protein DnaJ Herminiimonas arsenicoxydans
Q92T07 5.98e-143 413 54 5 384 3 dnaJ Chaperone protein DnaJ Rhizobium meliloti (strain 1021)
A1AW21 1.15e-142 412 55 3 374 3 dnaJ Chaperone protein DnaJ Ruthia magnifica subsp. Calyptogena magnifica
A6UEY1 1.33e-142 412 54 5 381 3 dnaJ Chaperone protein DnaJ Sinorhizobium medicae (strain WSM419)
B9KPP3 9.18e-142 410 52 5 386 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B5ZWQ1 1.03e-141 410 56 3 379 3 dnaJ Chaperone protein DnaJ Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q3IYM8 1.35e-141 410 52 5 387 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q5NFG8 2.06e-141 409 54 3 378 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GX0 2.06e-141 409 54 3 378 3 dnaJ Chaperone protein DnaJ Francisella tularensis subsp. tularensis (strain FSC 198)
Q31HA6 2.5e-141 409 55 1 373 3 dnaJ Chaperone protein DnaJ Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q6G553 4.77e-141 409 51 5 380 3 dnaJ Chaperone protein DnaJ Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A1WX30 5.71e-141 409 56 3 384 3 dnaJ Chaperone protein DnaJ Halorhodospira halophila (strain DSM 244 / SL1)
A3PNM0 7.15e-141 408 52 5 387 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q6F6R1 1.06e-140 407 58 6 379 3 dnaJ Chaperone protein DnaJ Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2KDW7 1.83e-140 407 55 4 379 3 dnaJ Chaperone protein DnaJ Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PXH2 3.72e-140 406 55 4 379 3 dnaJ Chaperone protein DnaJ Rhizobium etli (strain CIAT 652)
B0TYF3 6.34e-140 405 53 3 378 3 dnaJ Chaperone protein DnaJ Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q1MN12 8.61e-140 405 55 4 379 3 dnaJ Chaperone protein DnaJ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B6IVA5 4.86e-139 403 53 4 381 3 dnaJ Chaperone protein DnaJ Rhodospirillum centenum (strain ATCC 51521 / SW)
Q6G1F8 4.04e-138 401 51 5 380 3 dnaJ Chaperone protein DnaJ Bartonella quintana (strain Toulouse)
Q98DD2 4.73e-138 401 53 5 379 3 dnaJ Chaperone protein DnaJ Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B5ENA2 1.36e-137 400 56 2 377 3 dnaJ Chaperone protein DnaJ Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7X8 1.36e-137 400 56 2 377 3 dnaJ Chaperone protein DnaJ Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q11KJ5 3.79e-136 396 51 5 378 3 dnaJ Chaperone protein DnaJ Chelativorans sp. (strain BNC1)
B0VA24 7.02e-136 395 56 5 377 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AYE)
A3MA88 7.02e-136 395 56 5 377 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQ00 7.02e-136 395 56 5 377 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain SDF)
B2I2G6 7.02e-136 395 56 5 377 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain ACICU)
B7I2B2 7.02e-136 395 56 5 377 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AB0057)
B7GV08 7.02e-136 395 56 5 377 3 dnaJ Chaperone protein DnaJ Acinetobacter baumannii (strain AB307-0294)
B9JZ89 8.19e-136 395 52 5 388 3 dnaJ Chaperone protein DnaJ Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q1QET5 1.11e-135 395 57 3 379 3 dnaJ Chaperone protein DnaJ Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A4WW88 1.16e-135 395 52 5 387 3 dnaJ Chaperone protein DnaJ Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q4FVQ7 1.18e-135 395 56 3 379 3 dnaJ Chaperone protein DnaJ Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B9JGW2 1.71e-135 394 53 4 385 3 dnaJ Chaperone protein DnaJ Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A8IPT0 7.11e-135 393 52 5 380 3 dnaJ Chaperone protein DnaJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B2IBR5 2.69e-134 391 51 5 380 3 dnaJ Chaperone protein DnaJ Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A6WX07 9.48e-134 390 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A7HZ38 1.2e-131 385 51 4 385 3 dnaJ Chaperone protein DnaJ Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q8FXX1 1.38e-131 384 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella suis biovar 1 (strain 1330)
B0CJX5 1.38e-131 384 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YE77 1.38e-131 384 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RG11 1.38e-131 384 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella melitensis biotype 2 (strain ATCC 23457)
A9M9V9 1.38e-131 384 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B8IHL2 3e-131 384 52 5 388 3 dnaJ Chaperone protein DnaJ Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q57AD6 4.85e-131 383 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella abortus biovar 1 (strain 9-941)
Q2YQV1 4.85e-131 383 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella abortus (strain 2308)
B2S9C2 4.85e-131 383 53 4 378 3 dnaJ Chaperone protein DnaJ Brucella abortus (strain S19)
Q52702 4.88e-131 383 51 4 387 3 dnaJ Chaperone protein DnaJ Rhodobacter capsulatus
P22305 5.39e-131 383 50 4 386 3 dnaJ Chaperone protein DnaJ Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A9W6R8 1.22e-130 382 51 4 386 3 dnaJ Chaperone protein DnaJ Methylorubrum extorquens (strain PA1)
Q5LWJ5 1.24e-130 382 52 4 384 3 dnaJ Chaperone protein DnaJ Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q05980 1.27e-130 382 53 4 378 2 dnaJ Chaperone protein DnaJ Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q1GKS4 2.2e-130 382 50 5 388 3 dnaJ Chaperone protein DnaJ Ruegeria sp. (strain TM1040)
B1LZ52 3.86e-130 381 52 5 380 3 dnaJ Chaperone protein DnaJ Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q2VYT0 5.19e-130 380 53 4 381 3 dnaJ Chaperone protein DnaJ Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B0U833 6e-130 380 51 5 389 3 dnaJ Chaperone protein DnaJ Methylobacterium sp. (strain 4-46)
B1ZGR2 1.3e-129 380 51 4 384 3 dnaJ Chaperone protein DnaJ Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B7KSZ5 1.6e-129 379 51 4 386 3 dnaJ Chaperone protein DnaJ Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A5WBF8 6e-129 378 53 3 378 3 dnaJ Chaperone protein DnaJ Psychrobacter sp. (strain PRwf-1)
Q21CI1 7.56e-129 377 52 2 372 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain BisB18)
A7IC67 8.71e-129 377 51 4 379 3 dnaJ Chaperone protein DnaJ Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q5NPS5 1.7e-128 377 51 5 377 3 dnaJ Chaperone protein DnaJ Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q16D44 2.31e-128 377 51 4 371 3 dnaJ Chaperone protein DnaJ Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q2J319 2.4e-128 376 53 4 373 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain HaA2)
Q28VY4 8.53e-128 375 48 5 388 3 dnaJ Chaperone protein DnaJ Jannaschia sp. (strain CCS1)
Q75WD2 9.58e-128 375 52 6 377 3 dnaJ Chaperone protein DnaJ Acetobacter pasteurianus (strain NBRC 105184 / IFO 3283-01)
C5D4U0 4.22e-127 373 54 8 381 3 dnaJ Chaperone protein DnaJ Geobacillus sp. (strain WCH70)
Q93S23 2.66e-126 369 55 3 330 3 dnaJ Chaperone protein DnaJ (Fragment) Rhizobium tropici
Q9KWS6 1.39e-125 369 54 8 381 3 dnaJ Chaperone protein DnaJ Parageobacillus thermoglucosidasius
Q4FNQ0 4.5e-125 368 52 5 379 3 dnaJ Chaperone protein DnaJ Pelagibacter ubique (strain HTCC1062)
O08356 4.56e-125 368 53 4 373 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas sp. (strain No.7)
B3Q973 4.56e-125 368 53 4 373 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain TIE-1)
Q6NCY3 4.56e-125 368 53 4 373 3 dnaJ Chaperone protein DnaJ Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q74H58 1.24e-124 367 54 2 372 3 dnaJ Chaperone protein DnaJ Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q3A8C3 4.02e-124 365 50 3 376 3 dnaJ Chaperone protein DnaJ Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q0AKB3 9.2e-124 365 52 4 390 3 dnaJ Chaperone protein DnaJ Maricaulis maris (strain MCS10)
Q1RHG9 1.71e-122 361 50 6 356 3 dnaJ Chaperone protein DnaJ Rickettsia bellii (strain RML369-C)
A8GV67 2.29e-122 361 50 6 356 3 dnaJ Chaperone protein DnaJ Rickettsia bellii (strain OSU 85-389)
Q0C454 3.63e-122 361 50 4 380 3 dnaJ Chaperone protein DnaJ Hyphomonas neptunium (strain ATCC 15444)
Q9ZDY0 7e-122 359 50 3 346 3 dnaJ Chaperone protein DnaJ Rickettsia prowazekii (strain Madrid E)
A1B4F0 8.4e-122 360 49 8 389 3 dnaJ Chaperone protein DnaJ Paracoccus denitrificans (strain Pd 1222)
A8LQ63 1.15e-121 359 48 5 387 3 dnaJ Chaperone protein DnaJ Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q68XI3 5.61e-121 357 50 5 347 3 dnaJ Chaperone protein DnaJ Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9LCQ4 1.69e-120 356 51 6 377 3 dnaJ Chaperone protein DnaJ Brevibacillus choshinensis
B8CXL0 2.1e-120 356 50 5 376 3 dnaJ Chaperone protein DnaJ Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A0LJ41 2.11e-120 356 50 6 374 3 dnaJ Chaperone protein DnaJ Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
P94319 3.51e-120 355 52 4 374 3 dnaJ Chaperone protein DnaJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B0SRF0 4.6e-120 355 51 4 368 3 dnaJ Chaperone protein DnaJ Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SHT0 4.6e-120 355 51 4 368 3 dnaJ Chaperone protein DnaJ Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A8GMF8 1.6e-119 353 50 5 348 3 dnaJ Chaperone protein DnaJ Rickettsia akari (strain Hartford)
B1HUD0 4.05e-119 352 52 6 379 3 dnaJ Chaperone protein DnaJ Lysinibacillus sphaericus (strain C3-41)
A0Q1R3 4.62e-119 352 51 5 384 3 dnaJ Chaperone protein DnaJ Clostridium novyi (strain NT)
A8EXP6 4.35e-118 350 48 4 350 3 dnaJ Chaperone protein DnaJ Rickettsia canadensis (strain McKiel)
A8F0U0 8.45e-118 349 49 4 352 3 dnaJ Chaperone protein DnaJ Rickettsia massiliae (strain Mtu5)
A8FFD1 9.54e-118 349 52 6 380 3 dnaJ Chaperone protein DnaJ Bacillus pumilus (strain SAFR-032)
Q92J37 1.35e-117 348 49 4 349 3 dnaJ Chaperone protein DnaJ Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PMM6 1.35e-117 348 49 4 349 3 dnaJ Chaperone protein DnaJ Rickettsia africae (strain ESF-5)
C4K111 3.75e-117 347 49 4 349 3 dnaJ Chaperone protein DnaJ Rickettsia peacockii (strain Rustic)
Q24SS4 3.76e-117 348 51 4 379 3 dnaJ Chaperone protein DnaJ Desulfitobacterium hafniense (strain Y51)
B8FUN3 3.76e-117 348 51 4 379 3 dnaJ Chaperone protein DnaJ Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A7GT07 4.86e-117 347 52 5 354 3 dnaJ Chaperone protein DnaJ Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B0BWH0 8.96e-117 347 49 4 349 3 dnaJ Chaperone protein DnaJ Rickettsia rickettsii (strain Iowa)
Q5WHG0 2.55e-116 345 51 7 378 3 dnaJ Chaperone protein DnaJ Shouchella clausii (strain KSM-K16)
Q4UJK6 3.06e-116 345 49 4 347 3 dnaJ Chaperone protein DnaJ Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q8RB67 3.5e-116 345 48 4 386 3 dnaJ Chaperone protein DnaJ Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A8GR21 3.85e-116 345 48 4 349 3 dnaJ Chaperone protein DnaJ Rickettsia rickettsii (strain Sheila Smith)
O69269 4.68e-116 345 51 7 379 3 dnaJ Chaperone protein DnaJ Lysinibacillus sphaericus
A4IR30 1.01e-115 344 53 6 382 3 dnaJ Chaperone protein DnaJ Geobacillus thermodenitrificans (strain NG80-2)
Q182E7 1.61e-115 344 50 3 381 3 dnaJ Chaperone protein DnaJ Clostridioides difficile (strain 630)
A5CD86 1.99e-115 343 46 5 380 3 dnaJ Chaperone protein DnaJ Orientia tsutsugamushi (strain Boryong)
B8I304 3.44e-115 343 48 5 381 3 dnaJ Chaperone protein DnaJ Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A7Z6W0 4.51e-115 342 51 6 380 3 dnaJ Chaperone protein DnaJ Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P61441 4.71e-115 342 48 5 375 3 dnaJ Chaperone protein DnaJ Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P61440 4.71e-115 342 48 5 375 3 dnaJ Chaperone protein DnaJ Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q5KWZ8 6.39e-115 342 52 7 382 3 dnaJ Chaperone protein DnaJ Geobacillus kaustophilus (strain HTA426)
A6LRN5 1.74e-114 341 48 2 373 3 dnaJ Chaperone protein DnaJ Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B3CVD9 2.18e-114 340 45 5 380 3 dnaJ Chaperone protein DnaJ Orientia tsutsugamushi (strain Ikeda)
A3DF24 2.49e-114 341 49 3 365 3 dnaJ Chaperone protein DnaJ Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q65H55 3.64e-114 340 51 6 380 3 dnaJ Chaperone protein DnaJ Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9E6X0 6.27e-114 339 51 6 378 3 dnaJ Chaperone protein DnaJ Macrococcus caseolyticus (strain JCSC5402)
Q8CXD3 2.17e-113 338 51 4 354 3 dnaJ Chaperone protein DnaJ Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5FSL4 2.29e-113 338 48 6 380 3 dnaJ Chaperone protein DnaJ Gluconobacter oxydans (strain 621H)
P17631 3.1e-113 338 52 6 380 2 dnaJ Chaperone protein DnaJ Bacillus subtilis (strain 168)
A9KKT9 3.17e-113 338 49 4 359 3 dnaJ Chaperone protein DnaJ Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A4XKA5 4.44e-113 338 47 5 387 3 dnaJ Chaperone protein DnaJ Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MJZ0 5.52e-113 337 47 5 388 3 dnaJ Chaperone protein DnaJ Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B1ZUS0 1.93e-112 336 48 3 387 3 dnaJ Chaperone protein DnaJ Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
B1YKT0 3.01e-112 335 49 5 379 3 dnaJ Chaperone protein DnaJ Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q70WY6 9.29e-112 335 45 6 397 3 dnaJ Chaperone protein DnaJ Fusobacterium nucleatum subsp. polymorphum
C0ZB49 1.79e-111 333 49 6 377 3 dnaJ Chaperone protein DnaJ Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A5FZ18 2.71e-111 333 51 4 385 3 dnaJ Chaperone protein DnaJ Acidiphilium cryptum (strain JF-5)
Q2YT48 3.15e-111 333 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GGC1 3.29e-111 333 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MRSA252)
P63972 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MW2)
A8Z4B8 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8Y8 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain MSSA476)
P63971 3.84e-111 332 48 5 381 1 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain N315)
P63970 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHC2 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Newman)
Q5HFI1 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain COL)
A5ITA7 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain JH9)
Q2FXZ3 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGE4 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain USA300)
A6U251 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain JH1)
A7X2Y0 3.84e-111 332 48 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q5L6F7 4.96e-111 333 43 5 396 3 dnaJ Chaperone protein DnaJ Chlamydia abortus (strain DSM 27085 / S26/3)
Q5P9E0 1.02e-110 331 44 5 384 3 dnaJ Chaperone protein DnaJ Anaplasma marginale (strain St. Maries)
B9KH92 1.02e-110 331 44 5 384 3 dnaJ Chaperone protein DnaJ Anaplasma marginale (strain Florida)
Q6HDK8 3.49e-110 330 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81LS3 3.49e-110 330 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus anthracis
C3L5R6 3.49e-110 330 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8L9 3.49e-110 330 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus anthracis (strain A0248)
Q634M8 3.93e-110 330 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain ZK / E33L)
C1ESK7 3.93e-110 330 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain 03BB102)
B9IY80 5.57e-110 329 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain Q1)
B7HPL2 5.57e-110 329 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain AH187)
Q730M2 5.57e-110 329 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain ATCC 10987 / NRS 248)
Q892R1 9.48e-110 329 46 4 381 3 dnaJ Chaperone protein DnaJ Clostridium tetani (strain Massachusetts / E88)
B7HCT9 1.01e-109 328 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain B4264)
B7IYG6 1.01e-109 328 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain G9842)
Q5HNW7 1.56e-109 328 47 5 380 3 dnaJ Chaperone protein DnaJ Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B7JN38 2.05e-109 328 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain AH820)
Q8CP18 2.1e-109 328 48 5 380 3 dnaJ Chaperone protein DnaJ Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A9VHU0 2.14e-109 328 53 3 351 3 dnaJ Chaperone protein DnaJ Bacillus mycoides (strain KBAB4)
Q6AN63 2.87e-109 327 46 5 378 3 dnaJ Chaperone protein DnaJ Desulfotalea psychrophila (strain LSv54 / DSM 12343)
P45555 3.98e-109 327 47 5 381 3 dnaJ Chaperone protein DnaJ Staphylococcus aureus
O27352 4.84e-109 327 46 6 381 3 dnaJ Chaperone protein DnaJ Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q2GI75 6.84e-109 327 46 5 382 3 dnaJ Chaperone protein DnaJ Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q5HCG4 7.22e-109 327 45 6 388 3 dnaJ Chaperone protein DnaJ Ehrlichia ruminantium (strain Welgevonden)
Q2GLU9 8.69e-109 327 44 5 385 3 dnaJ Chaperone protein DnaJ Anaplasma phagocytophilum (strain HZ)
Q5FGQ8 1.9e-108 326 45 6 388 3 dnaJ Chaperone protein DnaJ Ehrlichia ruminantium (strain Gardel)
B8DQW8 1.9e-108 325 48 3 363 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q67S53 2.18e-108 326 47 2 377 3 dnaJ Chaperone protein DnaJ Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q818F0 5.71e-108 324 53 3 352 3 dnaJ Chaperone protein DnaJ Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8RH03 6.73e-108 325 47 5 378 3 dnaJ Chaperone protein DnaJ Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9KD71 1.73e-107 323 49 5 377 3 dnaJ Chaperone protein DnaJ Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8XIT1 1.74e-107 323 50 5 371 3 dnaJ Chaperone protein DnaJ Clostridium perfringens (strain 13 / Type A)
Q316U7 1.79e-107 323 47 3 351 3 dnaJ Chaperone protein DnaJ Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q71ZJ8 1.99e-107 323 51 6 380 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4b (strain F2365)
C1KVB9 1.99e-107 323 51 6 380 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4b (strain CLIP80459)
B8DE39 2.32e-107 323 51 6 380 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 4a (strain HCC23)
Q92BN9 2.32e-107 323 51 6 380 3 dnaJ Chaperone protein DnaJ Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AIS3 2.42e-107 323 51 6 380 3 dnaJ Chaperone protein DnaJ Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P0DJM1 2.76e-107 322 51 6 380 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
G2K045 2.76e-107 322 51 6 380 3 dnaJ Chaperone protein DnaJ Listeria monocytogenes serotype 1/2a (strain 10403S)
Q3YT99 2.93e-107 323 45 6 386 3 dnaJ Chaperone protein DnaJ Ehrlichia canis (strain Jake)
A9HEA1 4.91e-107 322 52 5 374 3 dnaJ Chaperone protein DnaJ Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A5N6M3 7.4e-107 322 47 6 382 3 dnaJ Chaperone protein DnaJ Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
A1V9Q3 8.63e-107 321 49 2 351 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain DP4)
Q725M6 8.63e-107 321 49 2 351 3 dnaJ Chaperone protein DnaJ Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O87778 3.42e-106 320 48 5 378 2 dnaJ Chaperone protein DnaJ Latilactobacillus sakei
Q8TQR1 3.42e-106 320 47 5 358 3 dnaJ Chaperone protein DnaJ Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A5UYW4 3.75e-106 319 45 4 353 3 dnaJ Chaperone protein DnaJ Roseiflexus sp. (strain RS-1)
Q38W94 4.78e-106 320 48 5 378 3 dnaJ Chaperone protein DnaJ Latilactobacillus sakei subsp. sakei (strain 23K)
P0CW06 9.04e-106 319 46 6 369 3 dnaJ Chaperone protein DnaJ Methanosarcina mazei
P0CW07 9.04e-106 319 46 6 369 3 dnaJ Chaperone protein DnaJ Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
B9DNJ9 1.36e-105 318 47 4 379 3 dnaJ Chaperone protein DnaJ Staphylococcus carnosus (strain TM300)
B2V2I6 1.89e-105 318 47 4 379 3 dnaJ Chaperone protein DnaJ Clostridium botulinum (strain Alaska E43 / Type E3)
P30725 2.82e-105 317 46 3 382 2 dnaJ Chaperone protein DnaJ Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2TLZ8 3.95e-105 317 47 4 379 3 dnaJ Chaperone protein DnaJ Clostridium botulinum (strain Eklund 17B / Type B)
Q49Y21 8.43e-105 316 46 4 380 3 dnaJ Chaperone protein DnaJ Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8DWH2 1.06e-104 316 47 6 384 3 dnaJ Chaperone protein DnaJ Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9UXR9 2.04e-104 315 47 10 389 3 dnaJ Chaperone protein DnaJ Methanosarcina thermophila
C6BYN5 2.79e-104 315 47 2 352 3 dnaJ Chaperone protein DnaJ Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q6ME07 5.55e-104 314 44 3 385 3 dnaJ Chaperone protein DnaJ Protochlamydia amoebophila (strain UWE25)
Q04Y48 9.13e-104 313 46 5 373 3 dnaJ Chaperone protein DnaJ Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04VC7 9.13e-104 313 46 5 373 3 dnaJ Chaperone protein DnaJ Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
C4L424 2.3e-103 312 51 7 379 3 dnaJ Chaperone protein DnaJ Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q5M6D0 2.67e-103 312 48 6 384 3 dnaJ Chaperone protein DnaJ Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1T7 2.67e-103 312 48 6 384 3 dnaJ Chaperone protein DnaJ Streptococcus thermophilus (strain CNRZ 1066)
Q8DKR7 3.15e-103 312 48 6 363 3 dnaJ Chaperone protein DnaJ Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q835R5 5.34e-103 312 47 5 386 3 dnaJ Chaperone protein DnaJ Enterococcus faecalis (strain ATCC 700802 / V583)
A7NS65 6.25e-103 311 44 4 353 3 dnaJ Chaperone protein DnaJ Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q6MNG0 8.01e-103 311 45 3 360 3 dnaJ Chaperone protein DnaJ Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q3AF07 2.54e-102 310 48 4 358 3 dnaJ Chaperone protein DnaJ Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q73IV4 2.82e-101 307 46 5 348 3 dnaJ Chaperone protein DnaJ Wolbachia pipientis wMel
Q7M9T3 6.56e-101 306 43 6 381 3 dnaJ Chaperone protein DnaJ Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q253T6 9.53e-101 306 42 3 393 3 dnaJ Chaperone protein DnaJ Chlamydia felis (strain Fe/C-56)
Q823T2 2.19e-100 305 41 4 396 3 dnaJ Chaperone protein DnaJ Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9Z9E9 3.9e-100 305 41 3 394 3 dnaJ Chaperone protein DnaJ Chlamydia pneumoniae
Q044A8 1.11e-99 303 43 7 394 3 dnaJ Chaperone protein DnaJ Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q73Q15 1.77e-99 303 43 6 371 3 dnaJ Chaperone protein DnaJ Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q74IT7 2.85e-99 302 43 6 389 3 dnaJ Chaperone protein DnaJ Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q93R26 4.04e-99 302 45 6 386 3 dnaJ Chaperone protein DnaJ Tetragenococcus halophilus
Q3K3T1 6.76e-99 301 46 6 379 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q9PK53 2.17e-98 300 40 3 394 3 dnaJ Chaperone protein DnaJ Chlamydia muridarum (strain MoPn / Nigg)
B0S1F7 2.77e-98 299 40 5 381 3 dnaJ Chaperone protein DnaJ Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
O84345 2.85e-98 300 40 3 394 3 dnaJ Chaperone protein DnaJ Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BBX5 2.85e-98 300 40 3 394 3 dnaJ Chaperone protein DnaJ Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KM17 2.85e-98 300 40 3 394 3 dnaJ Chaperone protein DnaJ Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B7R0 2.85e-98 300 40 3 394 3 dnaJ Chaperone protein DnaJ Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q7UM96 4.8e-98 299 45 4 380 3 dnaJ Chaperone protein DnaJ Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8E298 7.53e-98 298 46 6 384 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7Q7 8.66e-98 298 46 6 384 3 dnaJ Chaperone protein DnaJ Streptococcus agalactiae serotype III (strain NEM316)
Q8L397 1.15e-97 298 44 5 379 3 dnaJ Chaperone protein DnaJ Acholeplasma laidlawii
B0CAZ0 2.12e-97 297 45 7 353 3 dnaJ Chaperone protein DnaJ Acaryochloris marina (strain MBIC 11017)
B9DVF2 3.79e-97 296 46 4 381 3 dnaJ Chaperone protein DnaJ Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q84BU3 7.13e-97 296 42 6 389 3 dnaJ Chaperone protein DnaJ Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q1G9R3 7.67e-97 296 44 6 379 3 dnaJ Chaperone protein DnaJ Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q049W7 8.18e-97 296 44 6 379 3 dnaJ Chaperone protein DnaJ Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
B2G6W4 8.96e-97 296 47 8 387 3 dnaJ Chaperone protein DnaJ Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJE8 8.96e-97 296 47 8 387 3 dnaJ Chaperone protein DnaJ Limosilactobacillus reuteri (strain DSM 20016)
Q6A662 9.3e-97 296 42 9 378 3 dnaJ2 Chaperone protein DnaJ 2 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q7VG06 2.98e-96 295 43 6 360 3 dnaJ Chaperone protein DnaJ Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q114R3 4.23e-96 294 43 8 367 3 dnaJ Chaperone protein DnaJ Trichodesmium erythraeum (strain IMS101)
Q03FR6 2.19e-95 292 48 3 356 3 dnaJ Chaperone protein DnaJ Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B2GBQ6 2.3e-95 292 46 7 390 3 dnaJ Chaperone protein DnaJ Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q02VR5 2.46e-95 292 45 4 364 3 dnaJ Chaperone protein DnaJ Lactococcus lactis subsp. cremoris (strain SK11)
O33529 2.84e-95 286 61 2 234 3 dnaJ Chaperone protein DnaJ (Fragment) Rhizobium leguminosarum
A2RP20 4.41e-95 291 45 4 364 3 dnaJ Chaperone protein DnaJ Lactococcus lactis subsp. cremoris (strain MG1363)
P95830 5.19e-95 291 47 5 381 1 dnaJ Chaperone protein DnaJ Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A8EUC7 5.47e-95 291 42 7 382 3 dnaJ Chaperone protein DnaJ Aliarcobacter butzleri (strain RM4018)
B5YAR4 9.15e-95 291 45 8 390 3 dnaJ Chaperone protein DnaJ Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q8CWT2 9.4e-95 290 47 5 378 3 dnaJ Chaperone protein DnaJ Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q038N5 1.45e-94 290 46 5 385 3 dnaJ Chaperone protein DnaJ Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WEQ6 1.45e-94 290 46 5 385 3 dnaJ Chaperone protein DnaJ Lacticaseibacillus casei (strain BL23)
Q45552 1.63e-94 290 46 11 389 3 dnaJ Chaperone protein DnaJ Geobacillus stearothermophilus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00050
Feature type CDS
Gene dnaJ
Product molecular chaperone DnaJ
Location 20133 - 21269 (strand: 1)
Length 1137 (nucleotides) / 378 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_171
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00226 DnaJ domain
PF00684 DnaJ central domain
PF01556 DnaJ C terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0484 Posttranslational modification, protein turnover, chaperones (O) O DnaJ-class molecular chaperone with C-terminal Zn finger domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03686 molecular chaperone DnaJ - -

Protein Sequence

MAKRDFYEVLGLSKTADEKEIKRAYKRLAMKYHPDRNQGDKDSESKFKEIKEAYEVLSDPQKRAAYDQYGHAAFEQGGFGGQGGGGFGGADFSDIFGDVFGDIFGGGRRQQRAARGSDLQYNMDLTLEEAVRGITKEIRIPTLETCDKCHGSGAKEGTSAETCSTCHGAGQVHLRQGFFTVQQPCPTCHGRGKVIKEPCSKCHGDGRVERYKTLSVKIPAGVDTGDRIRLSGEGEAGEQGAPAGDLYVQVHVRQHHIFERDGNNLYCEVPINFAVAALGGEIEVPTLDGRVKLKIPAETQTGKMFRMKGKGVKSVRSHGVGDLMCRVVVETPVKLNEKQKQLMEQLGESFGGKGGEKNTPRSKSFLDGVKKFFDDLTK

Flanking regions ( +/- flanking 50bp)

GGCGTCGAGGCAACTCTACGCCCGTGTGCTTATGTCAAGGGTAATCCAGAATGGCGAAAAGAGATTTTTACGAAGTACTCGGGTTAAGTAAAACAGCCGATGAAAAAGAGATCAAACGTGCTTATAAGCGTTTAGCGATGAAATATCACCCAGATCGTAATCAAGGTGATAAAGATTCGGAATCTAAATTTAAAGAAATTAAAGAAGCTTACGAAGTTCTTAGCGATCCACAAAAACGTGCGGCCTATGATCAATATGGTCATGCTGCCTTTGAACAAGGTGGTTTTGGTGGTCAAGGCGGTGGTGGCTTTGGTGGCGCTGACTTTAGCGATATCTTTGGTGATGTGTTTGGCGATATTTTTGGTGGTGGTCGTCGTCAACAACGTGCTGCACGCGGCTCAGATTTGCAATACAACATGGACTTAACGCTAGAAGAAGCTGTTCGTGGTATTACCAAAGAGATCCGCATTCCAACCTTAGAAACCTGTGATAAATGCCACGGAAGTGGGGCAAAAGAAGGCACATCAGCGGAAACTTGCTCAACATGTCATGGGGCAGGTCAGGTTCATTTACGTCAAGGTTTCTTCACCGTTCAACAACCATGCCCTACCTGTCATGGTCGCGGTAAAGTAATTAAAGAGCCTTGCTCTAAATGTCATGGTGATGGCCGTGTTGAACGTTATAAAACCTTATCAGTTAAAATCCCGGCGGGAGTGGATACCGGTGATCGTATTCGTTTAAGTGGTGAAGGTGAAGCGGGTGAGCAAGGAGCACCGGCAGGCGATCTGTATGTACAGGTTCATGTTCGTCAGCACCATATATTTGAACGAGATGGTAATAACCTCTATTGCGAAGTACCTATTAACTTTGCGGTTGCAGCATTAGGGGGAGAAATTGAGGTGCCAACTCTCGATGGTCGTGTGAAACTAAAAATTCCAGCAGAAACACAAACTGGCAAAATGTTCCGCATGAAAGGCAAAGGTGTTAAATCTGTACGTAGCCATGGTGTCGGTGATTTAATGTGCCGTGTTGTTGTTGAAACGCCAGTGAAACTGAATGAAAAACAAAAGCAGCTTATGGAACAGCTAGGTGAATCATTTGGTGGTAAAGGTGGTGAAAAAAATACACCGCGCTCTAAGAGTTTCTTAGATGGAGTAAAAAAATTCTTTGATGATTTAACCAAATAATTTTTGCGTTATCTTCATTCCCAAAAAGCCTGATAATGTATTGCCTATCA