Homologs in group_1259

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07335 FBDBKF_07335 75.7 Morganella morganii S1 matP macrodomain Ter protein MatP
EHELCC_03635 EHELCC_03635 75.7 Morganella morganii S2 matP macrodomain Ter protein MatP
NLDBIP_03635 NLDBIP_03635 75.7 Morganella morganii S4 matP macrodomain Ter protein MatP
LHKJJB_09465 LHKJJB_09465 75.7 Morganella morganii S3 matP macrodomain Ter protein MatP
HKOGLL_09510 HKOGLL_09510 75.7 Morganella morganii S5 matP macrodomain Ter protein MatP
F4V73_RS01520 F4V73_RS01520 74.3 Morganella psychrotolerans matP macrodomain Ter protein MatP

Distribution of the homologs in the orthogroup group_1259

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1259

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N603 6.56e-78 231 74 0 147 3 matP Macrodomain Ter protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JMT1 2.5e-77 229 73 0 150 3 matP Macrodomain Ter protein Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1RDQ8 1.06e-75 225 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain UTI89 / UPEC)
Q8FJ81 1.06e-75 225 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A9M5 1.06e-75 225 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O1:K1 / APEC
B7MS67 1.06e-75 225 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O81 (strain ED1a)
B7MIA9 1.06e-75 225 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UN35 1.06e-75 225 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LJ43 2.19e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain SMS-3-5 / SECEC)
Q3Z3G5 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Shigella sonnei (strain Ss046)
P0A8N2 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Shigella flexneri
Q0T679 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Shigella flexneri serotype 5b (strain 8401)
Q32HV1 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Shigella dysenteriae serotype 1 (strain Sd197)
Q31YL9 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Shigella boydii serotype 4 (strain Sb227)
B6I930 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain SE11)
B7N3B8 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8N0 3.46e-75 224 74 0 150 1 matP Macrodomain Ter protein Escherichia coli (strain K12)
B1IVX6 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYQ8 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O9:H4 (strain HS)
B1X8R0 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain K12 / DH10B)
C4ZQ82 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain K12 / MC4100 / BW2952)
B7NM18 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT86 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8N1 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O157:H7
B7LE56 3.46e-75 224 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain 55989 / EAEC)
B1JQQ8 3.7e-75 224 70 0 150 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CF1 3.7e-75 224 70 0 150 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZG78 3.7e-75 224 70 0 150 1 matP Macrodomain Ter protein Yersinia pestis
B2JYT3 3.7e-75 224 70 0 150 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FJT1 3.7e-75 224 70 0 150 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7MFW6 3.91e-75 224 74 0 147 3 matP Macrodomain Ter protein Cronobacter sakazakii (strain ATCC BAA-894)
B7M885 4.31e-75 223 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O8 (strain IAI1)
A7ZK59 4.31e-75 223 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O139:H28 (strain E24377A / ETEC)
B2VDE5 4.97e-75 223 74 0 147 3 matP Macrodomain Ter protein Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q0TJA5 6.84e-75 223 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B2TTT9 1.32e-74 222 74 0 150 3 matP Macrodomain Ter protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A8AIC3 1.56e-74 222 74 0 150 3 matP Macrodomain Ter protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
D2TS86 2.07e-74 222 74 0 150 3 matP Macrodomain Ter protein Citrobacter rodentium (strain ICC168)
B5XY49 2.14e-74 222 73 0 150 3 matP Macrodomain Ter protein Klebsiella pneumoniae (strain 342)
B7LNW6 3.21e-74 221 73 0 150 3 matP Macrodomain Ter protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A9MHT3 3.9e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZQ68 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TSI2 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella schwarzengrund (strain CVM19633)
B5BBL1 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella paratyphi A (strain AKU_12601)
C0Q8D6 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella paratyphi C (strain RKS4594)
A9N6X2 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGD4 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T1Z9 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella newport (strain SL254)
B4TDZ6 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella heidelberg (strain SL476)
B5R6C2 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZF9 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella enteritidis PT4 (strain P125109)
B5FQZ9 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella dublin (strain CT_02021853)
Q57QT4 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella choleraesuis (strain SC-B67)
B5F1V3 4.08e-74 221 75 0 147 3 matP Macrodomain Ter protein Salmonella agona (strain SL483)
Q8Z7S1 1.05e-73 220 74 0 147 3 matP Macrodomain Ter protein Salmonella typhi
A6T750 1.22e-73 220 73 0 150 3 matP Macrodomain Ter protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4W8W8 2.32e-71 214 72 0 147 3 matP Macrodomain Ter protein Enterobacter sp. (strain 638)
B7VNL8 9.58e-58 179 58 0 151 3 matP Macrodomain Ter protein Vibrio atlanticus (strain LGP32)
Q7MKW4 1.84e-54 171 55 0 147 3 matP Macrodomain Ter protein Vibrio vulnificus (strain YJ016)
A7N0M1 6.2e-54 170 53 0 147 3 matP Macrodomain Ter protein Vibrio campbellii (strain ATCC BAA-1116)
Q8D9H5 7.63e-54 169 54 0 147 3 matP Macrodomain Ter protein Vibrio vulnificus (strain CMCP6)
B6ELS5 3.65e-53 168 56 0 147 3 matP Macrodomain Ter protein Aliivibrio salmonicida (strain LFI1238)
Q87PC8 2.26e-52 166 53 0 147 3 matP Macrodomain Ter protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LR94 3.06e-51 163 52 0 148 3 matP Macrodomain Ter protein Photobacterium profundum (strain SS9)
Q9KS02 6.56e-51 162 53 0 147 3 matP Macrodomain Ter protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CNF0 1.22e-48 156 53 0 147 3 matP Macrodomain Ter protein Pasteurella multocida (strain Pm70)
P44161 2.09e-46 150 51 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UC89 2.09e-46 150 51 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain PittEE)
A5UEY9 4.55e-46 150 50 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain PittGG)
Q4QKK3 5.65e-46 150 50 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain 86-028NP)
Q7VPB1 4.66e-38 129 46 0 147 3 matP Macrodomain Ter protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03850
Feature type CDS
Gene matP
Product macrodomain Ter protein MatP
Location 872704 - 873171 (strand: 1)
Length 468 (nucleotides) / 155 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1259
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06303 MatP N-terminal domain
PF17414 MatP C-terminal ribbon-helix-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3120 Replication, recombination and repair (L) L Macrodomain Ter protein organizer, MatP/YcbG family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09911 uncharacterized protein - -

Protein Sequence

MKYQQLENLECGWKWAYLVKKHREGELITRYVEKSAADEVVEQLLRLESQPLKVLEWINLHMNPELSNRMKQTIRARRKRYFNAEHQHTRKKSIDLTFKVWQRLSALSQRRGLTLSETIVQLIEDAERKEQYALKVHNLKDGLIELLERDKQKKE

Flanking regions ( +/- flanking 50bp)

GCAAAATTGTTGATATGCTAGTATGTAGTTACGTTGTCACGGTGATTTGTATGAAATATCAACAGTTAGAAAATCTAGAATGTGGCTGGAAGTGGGCTTATTTGGTAAAAAAACATCGCGAAGGTGAATTAATCACCCGTTATGTTGAAAAGAGCGCTGCCGATGAAGTGGTTGAGCAACTATTACGCCTTGAATCTCAACCATTAAAAGTCCTTGAATGGATCAACTTACATATGAACCCTGAGTTATCGAATAGAATGAAGCAAACTATTCGTGCTCGAAGAAAGCGTTATTTTAATGCTGAACATCAGCATACGCGTAAAAAATCTATCGATTTAACTTTTAAGGTTTGGCAACGCCTATCAGCACTATCTCAGCGCCGAGGTTTGACATTATCAGAAACGATTGTCCAGCTTATCGAAGATGCGGAGCGAAAAGAGCAGTATGCACTAAAAGTACATAACCTAAAAGATGGCCTAATTGAGTTACTAGAACGAGACAAACAGAAAAAAGAGTAGATGACAATAGCGTTGTTTATTATCGAGAGATCATCAGTATAGCGTTAACT