Homologs in group_1259

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07335 FBDBKF_07335 89.5 Morganella morganii S1 matP macrodomain Ter protein MatP
EHELCC_03635 EHELCC_03635 89.5 Morganella morganii S2 matP macrodomain Ter protein MatP
NLDBIP_03635 NLDBIP_03635 89.5 Morganella morganii S4 matP macrodomain Ter protein MatP
LHKJJB_09465 LHKJJB_09465 89.5 Morganella morganii S3 matP macrodomain Ter protein MatP
HKOGLL_09510 HKOGLL_09510 89.5 Morganella morganii S5 matP macrodomain Ter protein MatP
PMI_RS03850 PMI_RS03850 74.3 Proteus mirabilis HI4320 matP macrodomain Ter protein MatP

Distribution of the homologs in the orthogroup group_1259

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1259

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8AIC3 4.78e-81 238 74 0 150 3 matP Macrodomain Ter protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JMT1 1.36e-80 237 74 0 150 3 matP Macrodomain Ter protein Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZQ68 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TSI2 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella schwarzengrund (strain CVM19633)
B5BBL1 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella paratyphi A (strain AKU_12601)
C0Q8D6 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella paratyphi C (strain RKS4594)
A9N6X2 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGD4 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T1Z9 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella newport (strain SL254)
B4TDZ6 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella heidelberg (strain SL476)
B5R6C2 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZF9 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella enteritidis PT4 (strain P125109)
B5FQZ9 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella dublin (strain CT_02021853)
Q57QT4 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella choleraesuis (strain SC-B67)
B5F1V3 1.38e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella agona (strain SL483)
Q8Z7S1 1.92e-80 237 75 0 148 3 matP Macrodomain Ter protein Salmonella typhi
Q3Z3G5 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Shigella sonnei (strain Ss046)
P0A8N2 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Shigella flexneri
Q0T679 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Shigella flexneri serotype 5b (strain 8401)
Q32HV1 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Shigella dysenteriae serotype 1 (strain Sd197)
Q31YL9 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Shigella boydii serotype 4 (strain Sb227)
B6I930 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain SE11)
B7N3B8 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8N0 2.1e-80 237 74 0 150 1 matP Macrodomain Ter protein Escherichia coli (strain K12)
B1IVX6 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYQ8 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O9:H4 (strain HS)
B1X8R0 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain K12 / DH10B)
C4ZQ82 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain K12 / MC4100 / BW2952)
B7NM18 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT86 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8N1 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O157:H7
B7LE56 2.1e-80 237 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain 55989 / EAEC)
D2TS86 2.29e-80 236 74 0 150 3 matP Macrodomain Ter protein Citrobacter rodentium (strain ICC168)
B7M885 6.29e-80 236 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O8 (strain IAI1)
A7ZK59 6.29e-80 236 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MHT3 8.64e-80 235 75 0 148 3 matP Macrodomain Ter protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B2TTT9 9.75e-80 235 74 0 150 3 matP Macrodomain Ter protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDQ8 1.05e-79 235 74 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain UTI89 / UPEC)
Q8FJ81 1.05e-79 235 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A9M5 1.05e-79 235 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O1:K1 / APEC
B7MS67 1.05e-79 235 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O81 (strain ED1a)
B7MIA9 1.05e-79 235 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UN35 1.05e-79 235 74 0 150 3 matP Macrodomain Ter protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7MFW6 1.42e-79 234 74 0 148 3 matP Macrodomain Ter protein Cronobacter sakazakii (strain ATCC BAA-894)
B7LNW6 1.74e-79 234 73 0 150 3 matP Macrodomain Ter protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LJ43 2.15e-79 234 73 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain SMS-3-5 / SECEC)
Q0TJA5 1.04e-78 233 73 0 150 3 matP Macrodomain Ter protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A6T750 4.67e-78 231 73 0 150 3 matP Macrodomain Ter protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XY49 4.67e-78 231 72 0 150 3 matP Macrodomain Ter protein Klebsiella pneumoniae (strain 342)
B1JQQ8 4.94e-78 231 72 0 150 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CF1 4.94e-78 231 72 0 150 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZG78 4.94e-78 231 72 0 150 1 matP Macrodomain Ter protein Yersinia pestis
B2JYT3 4.94e-78 231 72 0 150 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FJT1 4.94e-78 231 72 0 150 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N603 4.94e-78 231 72 0 148 3 matP Macrodomain Ter protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4W8W8 2.12e-76 227 70 0 148 3 matP Macrodomain Ter protein Enterobacter sp. (strain 638)
B2VDE5 3.25e-74 221 71 0 148 3 matP Macrodomain Ter protein Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7N0M1 7.75e-61 187 58 0 149 3 matP Macrodomain Ter protein Vibrio campbellii (strain ATCC BAA-1116)
Q87PC8 4.57e-60 185 58 0 149 3 matP Macrodomain Ter protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VNL8 2.33e-59 184 58 0 151 3 matP Macrodomain Ter protein Vibrio atlanticus (strain LGP32)
Q6LR94 1e-56 177 56 0 148 3 matP Macrodomain Ter protein Photobacterium profundum (strain SS9)
B6ELS5 1.81e-56 176 57 0 147 3 matP Macrodomain Ter protein Aliivibrio salmonicida (strain LFI1238)
Q7MKW4 1e-54 172 54 0 148 3 matP Macrodomain Ter protein Vibrio vulnificus (strain YJ016)
Q9KS02 1.52e-54 171 54 0 148 3 matP Macrodomain Ter protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8D9H5 4.35e-54 170 54 0 148 3 matP Macrodomain Ter protein Vibrio vulnificus (strain CMCP6)
P44161 1.85e-47 153 48 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UC89 1.85e-47 153 48 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain PittEE)
A5UEY9 4.52e-47 152 48 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain PittGG)
Q4QKK3 5.57e-47 152 48 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain 86-028NP)
Q9CNF0 4.4e-45 147 48 0 147 3 matP Macrodomain Ter protein Pasteurella multocida (strain Pm70)
Q7VPB1 6.34e-38 129 44 0 147 3 matP Macrodomain Ter protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01520
Feature type CDS
Gene matP
Product macrodomain Ter protein MatP
Location 340065 - 340523 (strand: 1)
Length 459 (nucleotides) / 152 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1259
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06303 MatP N-terminal domain
PF17414 MatP C-terminal ribbon-helix-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3120 Replication, recombination and repair (L) L Macrodomain Ter protein organizer, MatP/YcbG family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09911 uncharacterized protein - -

Protein Sequence

MKYQQLENLECGWKWAYLVKKHREGEAITRHVEKSQADEAVALLLKLESHPVKVIGWIQQHMSPVFINRMSQTIRARRKRHFNAEQQHTRKKSVDLEFLVWQRLSALSQRRGSTLSDTIIQLLEDAERKEKYATKMTSLKEDLQNLLGSDKK

Flanking regions ( +/- flanking 50bp)

ACAAATATTGCTATGCTTATGAAAGTGTTACCCTGTCACTGAGAAAAATAATGAAATATCAACAACTAGAGAACCTTGAGTGCGGCTGGAAGTGGGCGTATCTGGTCAAAAAACACCGCGAAGGTGAAGCTATTACCCGGCATGTGGAAAAAAGTCAGGCAGACGAGGCGGTTGCACTGCTGCTGAAACTGGAATCTCACCCCGTTAAAGTTATTGGCTGGATACAACAGCATATGTCGCCGGTATTTATAAACCGGATGAGTCAGACTATCCGTGCCCGTCGTAAGCGTCATTTTAATGCTGAGCAACAGCATACCCGCAAAAAATCTGTCGATTTGGAGTTTTTGGTCTGGCAGCGCTTATCTGCACTATCACAGCGACGCGGCAGTACATTGTCAGACACTATTATTCAGCTGCTGGAAGATGCGGAGCGGAAAGAAAAATACGCGACGAAAATGACGTCACTGAAGGAAGATCTGCAAAATTTACTGGGCAGCGACAAAAAATAAACCCCATCCGGAGACGGGGTTTATAAATTCATTGCATCATGCAATCGAAT