Homologs in group_1317

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07335 FBDBKF_07335 100.0 Morganella morganii S1 matP macrodomain Ter protein MatP
NLDBIP_03635 NLDBIP_03635 100.0 Morganella morganii S4 matP macrodomain Ter protein MatP
LHKJJB_09465 LHKJJB_09465 100.0 Morganella morganii S3 matP macrodomain Ter protein MatP
HKOGLL_09510 HKOGLL_09510 100.0 Morganella morganii S5 matP macrodomain Ter protein MatP
F4V73_RS01520 F4V73_RS01520 89.5 Morganella psychrotolerans matP macrodomain Ter protein MatP
PMI_RS03850 PMI_RS03850 75.7 Proteus mirabilis HI4320 matP macrodomain Ter protein MatP

Distribution of the homologs in the orthogroup group_1317

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1317

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
D2TS86 5.39e-82 241 76 0 150 3 matP Macrodomain Ter protein Citrobacter rodentium (strain ICC168)
Q8ZQ68 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TSI2 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella schwarzengrund (strain CVM19633)
B5BBL1 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella paratyphi A (strain AKU_12601)
C0Q8D6 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella paratyphi C (strain RKS4594)
A9N6X2 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGD4 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T1Z9 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella newport (strain SL254)
B4TDZ6 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella heidelberg (strain SL476)
B5R6C2 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZF9 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella enteritidis PT4 (strain P125109)
B5FQZ9 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella dublin (strain CT_02021853)
Q57QT4 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella choleraesuis (strain SC-B67)
B5F1V3 5.51e-82 241 77 0 148 3 matP Macrodomain Ter protein Salmonella agona (strain SL483)
Q8Z7S1 6.86e-82 240 77 0 148 3 matP Macrodomain Ter protein Salmonella typhi
A9MHT3 3.52e-81 239 76 0 148 3 matP Macrodomain Ter protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1RDQ8 7.25e-81 238 76 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain UTI89 / UPEC)
Q8FJ81 7.25e-81 238 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A9M5 7.25e-81 238 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O1:K1 / APEC
B7MS67 7.25e-81 238 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O81 (strain ED1a)
B7MIA9 7.25e-81 238 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UN35 7.25e-81 238 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8AIC3 1.51e-80 237 74 0 150 3 matP Macrodomain Ter protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1LJ43 1.8e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain SMS-3-5 / SECEC)
Q3Z3G5 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Shigella sonnei (strain Ss046)
P0A8N2 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Shigella flexneri
Q0T679 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Shigella flexneri serotype 5b (strain 8401)
Q32HV1 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Shigella dysenteriae serotype 1 (strain Sd197)
Q31YL9 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Shigella boydii serotype 4 (strain Sb227)
B6I930 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain SE11)
B7N3B8 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8N0 2.22e-80 237 76 0 150 1 matP Macrodomain Ter protein Escherichia coli (strain K12)
B1IVX6 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYQ8 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O9:H4 (strain HS)
B1X8R0 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain K12 / DH10B)
C4ZQ82 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain K12 / MC4100 / BW2952)
B7NM18 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT86 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8N1 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O157:H7
B7LE56 2.22e-80 237 76 0 150 3 matP Macrodomain Ter protein Escherichia coli (strain 55989 / EAEC)
A1JMT1 2.65e-80 236 75 0 150 3 matP Macrodomain Ter protein Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q0TJA5 4.68e-80 236 75 0 150 3 matP Macrodomain Ter protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7LNW6 4.94e-80 236 75 0 150 3 matP Macrodomain Ter protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7M885 5.22e-80 236 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O8 (strain IAI1)
A7ZK59 5.22e-80 236 76 0 150 3 matP Macrodomain Ter protein Escherichia coli O139:H28 (strain E24377A / ETEC)
B2TTT9 1.35e-79 234 76 0 150 3 matP Macrodomain Ter protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q7N603 4.06e-79 233 72 0 148 3 matP Macrodomain Ter protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JQQ8 4.24e-79 233 74 0 147 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CF1 4.24e-79 233 74 0 147 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZG78 4.24e-79 233 74 0 147 1 matP Macrodomain Ter protein Yersinia pestis
B2JYT3 4.24e-79 233 74 0 147 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FJT1 4.24e-79 233 74 0 147 3 matP Macrodomain Ter protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A6T750 7.09e-79 233 74 0 150 3 matP Macrodomain Ter protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XY49 1.17e-78 232 74 0 150 3 matP Macrodomain Ter protein Klebsiella pneumoniae (strain 342)
A7MFW6 1.84e-77 229 73 0 148 3 matP Macrodomain Ter protein Cronobacter sakazakii (strain ATCC BAA-894)
A4W8W8 5.88e-77 228 72 0 148 3 matP Macrodomain Ter protein Enterobacter sp. (strain 638)
B2VDE5 2.76e-76 226 73 0 148 3 matP Macrodomain Ter protein Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7N0M1 2.55e-59 183 57 0 149 3 matP Macrodomain Ter protein Vibrio campbellii (strain ATCC BAA-1116)
Q87PC8 1.94e-57 179 56 0 149 3 matP Macrodomain Ter protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6ELS5 3.43e-57 178 59 0 147 3 matP Macrodomain Ter protein Aliivibrio salmonicida (strain LFI1238)
B7VNL8 2.35e-56 176 56 0 151 3 matP Macrodomain Ter protein Vibrio atlanticus (strain LGP32)
Q7MKW4 3.4e-55 173 56 0 148 3 matP Macrodomain Ter protein Vibrio vulnificus (strain YJ016)
Q9KS02 5.81e-55 172 56 0 148 3 matP Macrodomain Ter protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6LR94 8.81e-55 172 56 0 148 3 matP Macrodomain Ter protein Photobacterium profundum (strain SS9)
Q8D9H5 1.81e-54 171 55 0 148 3 matP Macrodomain Ter protein Vibrio vulnificus (strain CMCP6)
P44161 9.12e-50 159 49 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UC89 9.12e-50 159 49 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain PittEE)
A5UEY9 1.92e-49 158 48 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain PittGG)
Q4QKK3 2.26e-49 158 48 0 147 3 matP Macrodomain Ter protein Haemophilus influenzae (strain 86-028NP)
Q9CNF0 9.38e-48 154 50 0 147 3 matP Macrodomain Ter protein Pasteurella multocida (strain Pm70)
Q7VPB1 7.22e-38 129 45 0 147 3 matP Macrodomain Ter protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03635
Feature type CDS
Gene matP
Product macrodomain Ter protein MatP
Location 34106 - 34564 (strand: -1)
Length 459 (nucleotides) / 152 (amino acids)
In genomic island -

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1317
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06303 MatP N-terminal domain
PF17414 MatP C-terminal ribbon-helix-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3120 Replication, recombination and repair (L) L Macrodomain Ter protein organizer, MatP/YcbG family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09911 uncharacterized protein - -

Protein Sequence

MKYQQLENLECGWKWAYLVKKHREGEEITRYTEKSRAEEAVAQLLKLESHPVKVTVWIQKHMAPGLANRMSQTIRARRKRHFNAEQQHTRKKSVDLEFLVWQRLSALSQRRGSTLSDTIVQLLEDAERKEKYATKMTSLKEDLQSLLGTDKK

Flanking regions ( +/- flanking 50bp)

GGGAATATTGCTATGCTTATGTCAGTGTTACCCTGTCACTGAGAAAAATCATGAAATATCAGCAACTAGAGAATCTTGAATGTGGCTGGAAGTGGGCATATCTGGTCAAAAAACACCGCGAAGGTGAGGAAATTACCCGTTATACGGAAAAAAGCCGGGCTGAGGAAGCGGTGGCGCAGTTACTGAAACTGGAGTCACATCCGGTAAAAGTGACGGTGTGGATACAAAAACATATGGCACCGGGACTGGCGAACCGGATGAGTCAGACTATCCGTGCACGGCGCAAGCGGCATTTTAATGCTGAGCAGCAGCATACCCGCAAAAAATCGGTTGATCTGGAGTTTCTGGTCTGGCAGCGGCTGTCGGCGTTATCACAGCGGCGCGGCAGTACCTTATCGGACACGATTGTGCAGTTGCTGGAAGATGCGGAGCGCAAGGAAAAGTACGCGACGAAGATGACATCGCTGAAGGAAGATCTGCAAAGCCTGCTGGGAACAGACAAAAAATAAACCCCATCCGGAGATGGGGTTTATACAATTCATTGCATTGTGCAATCGAA