Homologs in group_73

Help

12 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS01565 F4V73_RS01565 86.2 Morganella psychrotolerans tnpA IS200/IS605 family transposase
PMI_RS04860 PMI_RS04860 96.4 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS12365 PMI_RS12365 97.1 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS14780 PMI_RS14780 97.1 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS15010 PMI_RS15010 97.8 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS15050 PMI_RS15050 95.7 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS15215 PMI_RS15215 97.8 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS16435 PMI_RS16435 92.8 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS16830 PMI_RS16830 97.1 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS17425 PMI_RS17425 97.1 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS17615 PMI_RS17615 97.1 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase
PMI_RS18465 PMI_RS18465 97.8 Proteus mirabilis HI4320 tnpA IS200/IS605 family transposase

Distribution of the homologs in the orthogroup group_73

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_73

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7DF83 2.6e-16 73 29 1 129 1 tnpA ISDra2 transposase TnpA Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P59696 3.14e-11 60 27 2 127 3 tnpA1 Transposase for insertion sequence element IS200 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P59697 3.14e-11 60 27 2 127 3 tnpA1 Transposase for insertion sequence element IS200 Salmonella typhi

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03735
Feature type CDS
Gene tnpA
Product IS200/IS605 family transposase
Location 841469 - 841885 (strand: -1)
Length 417 (nucleotides) / 138 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_73
Orthogroup size 13
N. genomes 2

Actions

Genomic region

Domains

PF01797 Transposase IS200 like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1943 Mobilome: prophages, transposons (X) X REP element-mobilizing transposase RayT

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07491 REP-associated tyrosine transposase - -

Protein Sequence

MKNETNIRRVRHCVFLMHVHLVFVTKYRRKIFDQDAIEKLRGYFASVCADFDVELVEMDGERDHVHLLINYPPKLAISNLVNSLKGVSSRLLRRDRPDIAQRDYYKGVLWSPSYFAGSCGGAAISIIRQYIEQQETPR

Flanking regions ( +/- flanking 50bp)

GGAATTTAAAGGCTTGTAGACGTTTCATATTATCTATTATACTTTGGTCTATGAAAAATGAAACTAATATTCGCCGTGTCAGACATTGTGTATTCCTGATGCACGTCCATTTGGTCTTTGTCACAAAATACAGGCGAAAAATATTTGATCAGGATGCCATTGAAAAATTGCGAGGCTACTTTGCCAGTGTTTGTGCTGATTTTGATGTTGAACTGGTTGAAATGGATGGGGAACGGGATCACGTTCATTTACTGATTAATTACCCGCCAAAACTGGCGATATCTAATCTGGTTAACAGCCTTAAAGGGGTATCGAGTCGATTACTTCGACGTGATCGTCCTGATATTGCCCAACGTGATTACTACAAGGGGGTTCTTTGGTCGCCAAGTTATTTCGCGGGGAGTTGTGGTGGCGCAGCAATATCCATTATCCGCCAGTACATTGAGCAACAGGAAACACCTCGTTAGTTAAAAAACCGCGCCTTATATCCCCTATCCCCGACCTGAAGGACGGGGTT