Homologs in group_398

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07185 FBDBKF_07185 47.9 Morganella morganii S1 cspC Cold shock protein, CspA family
EHELCC_03785 EHELCC_03785 47.9 Morganella morganii S2 cspC Cold shock protein, CspA family
NLDBIP_03785 NLDBIP_03785 47.9 Morganella morganii S4 cspC Cold shock protein, CspA family
LHKJJB_09615 LHKJJB_09615 47.9 Morganella morganii S3 cspC Cold shock protein, CspA family
HKOGLL_09360 HKOGLL_09360 47.9 Morganella morganii S5 cspC Cold shock protein, CspA family
F4V73_RS01370 F4V73_RS01370 50.7 Morganella psychrotolerans - cold shock domain-containing protein

Distribution of the homologs in the orthogroup group_398

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_398

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q89A90 1.34e-13 62 45 0 62 3 cspE Cold shock-like protein CspE Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P63238 3.12e-13 61 45 0 62 3 cspE Cold shock-like protein CspE Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P63237 3.12e-13 61 45 0 62 3 cspE Cold shock-like protein CspE Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P0A975 1.59e-12 59 45 0 62 3 cspE Cold shock-like protein CspE Shigella flexneri
E0J1Q3 1.59e-12 59 45 0 62 1 cspE Cold shock-like protein CspE Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0A972 1.59e-12 59 45 0 62 1 cspE Cold shock-like protein CspE Escherichia coli (strain K12)
P0A973 1.59e-12 59 45 0 62 3 cspE Cold shock-like protein CspE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A974 1.59e-12 59 45 0 62 3 cspE Cold shock-like protein CspE Escherichia coli O157:H7
P0CL01 8.07e-12 57 40 1 69 3 cspJ Cold shock-like protein CspJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WGN1 8.07e-12 57 40 1 69 2 cspJ Cold shock-like protein CspJ Salmonella typhimurium (strain SL1344)
P62171 1.61e-11 56 45 1 62 3 cspC Cold shock-like protein CspC Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P62170 1.61e-11 56 45 1 62 4 cspC Cold shock-like protein CspC Bacillus cereus
P62169 1.61e-11 56 45 1 62 3 cspC Cold shock-like protein CspC Bacillus anthracis
P0A362 2.41e-11 56 43 0 62 3 cspB Cold shock-like protein CspB Yersinia pestis
P0A363 2.41e-11 56 43 0 62 3 cspB Cold shock-like protein CspB Yersinia enterocolitica
P58726 3.61e-11 55 39 1 69 3 cspJ Cold shock-like protein CspJ Salmonella typhi
P36995 4.91e-11 55 45 0 62 1 cspB Cold shock-like protein CspB Escherichia coli (strain K12)
P0A986 6.03e-11 55 41 0 62 3 cspI Cold shock-like protein CspI Escherichia coli (strain K12)
P0A987 6.03e-11 55 41 0 62 3 cspI Cold shock-like protein CspI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P57407 6.64e-11 55 40 0 62 3 cspC Cold shock-like protein CspC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P42016 7.05e-11 55 40 1 65 2 cspB Cold shock protein CspB Geobacillus stearothermophilus
P41016 1.22e-10 54 40 1 65 1 cspB Cold shock protein CspB Bacillus caldolyticus
Q49XK3 1.4e-10 54 41 1 65 3 cspA Cold shock protein CspA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CP90 1.4e-10 54 41 1 65 3 cspA Cold shock protein CspA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPE0 1.4e-10 54 41 1 65 3 cspA Cold shock protein CspA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9S1B7 1.68e-10 54 41 0 62 2 cspA Cold shock-like protein CspA Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
Q4L6A7 1.93e-10 53 41 1 65 3 cspA Cold shock protein CspA Staphylococcus haemolyticus (strain JCSC1435)
P0A9Y4 2.24e-10 53 42 0 61 3 cspA Cold shock protein CspA Shigella flexneri
P0A9Y2 2.24e-10 53 42 0 61 3 cspA Cold shock protein CspA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9Y3 2.24e-10 53 42 0 61 3 cspA Cold shock protein CspA Salmonella typhi
P0A9Y5 2.24e-10 53 42 0 61 3 cspA Cold shock protein CspA Salmonella enteritidis
Q46664 2.24e-10 53 42 0 61 3 cspA Major cold shock protein Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
P0A9X9 2.24e-10 53 42 0 61 1 cspA Cold shock protein CspA Escherichia coli (strain K12)
P0A9Y0 2.24e-10 53 42 0 61 3 cspA Cold shock protein CspA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Y1 2.24e-10 53 42 0 61 3 cspA Cold shock protein CspA Escherichia coli O157:H7
P0A981 3.04e-10 53 40 0 62 3 cspG Cold shock-like protein CspG Shigella flexneri
P0A978 3.04e-10 53 40 0 62 1 cspG Cold shock-like protein CspG Escherichia coli (strain K12)
P0A979 3.04e-10 53 40 0 62 3 cspG Cold shock-like protein CspG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A980 3.04e-10 53 40 0 62 3 cspG Cold shock-like protein CspG Escherichia coli O157:H7
Q9KN00 3.18e-10 53 41 0 65 3 cspA Cold shock-like protein CspA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A9Y9 4.17e-10 53 40 0 61 3 cspC Cold shock-like protein CspC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9Z0 4.17e-10 53 40 0 61 3 cspC Cold shock-like protein CspC Salmonella typhi
E0J500 4.17e-10 53 40 0 61 1 cspC Cold shock-like protein CspC Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0A9Y6 4.17e-10 53 40 0 61 1 cspC Cold shock-like protein CspC Escherichia coli (strain K12)
P0A9Y7 4.17e-10 53 40 0 61 3 cspC Cold shock-like protein CspC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Y8 4.17e-10 53 40 0 61 3 cspC Cold shock-like protein CspC Escherichia coli O157:H7
Q45097 4.23e-10 53 44 1 61 4 cspB Cold shock-like protein CspB Bacillus cereus
Q7A0X3 4.48e-10 53 41 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain MW2)
Q6G9F9 4.48e-10 53 41 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain MSSA476)
Q6GH06 4.48e-10 53 41 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain MRSA252)
Q7A5P3 4.48e-10 53 41 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain N315)
Q7A2R8 4.48e-10 53 41 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG18 4.48e-10 53 41 1 65 1 cspA Cold shock protein CspA Staphylococcus aureus (strain COL)
Q2YY16 4.48e-10 53 41 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FYN2 4.48e-10 53 41 1 65 1 cspA Cold shock protein CspA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH36 4.48e-10 53 41 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain USA300)
O54310 5.39e-10 52 47 1 61 1 csp Cold shock-like protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q83RI9 6.17e-10 52 40 0 61 3 cspC Cold shock-like protein CspC Shigella flexneri
Q9VRN5 7.61e-10 55 35 0 64 2 lin-28 Protein lin-28 homolog Drosophila melanogaster
Q9S170 8.58e-10 52 40 0 62 2 cspG Cold shock-like protein CspG Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
P51777 1.22e-09 52 36 1 65 1 cspD Cold shock protein CspD Bacillus subtilis (strain 168)
P72366 1.48e-09 51 37 0 64 3 cspA Cold shock-like protein CspA Stigmatella aurantiaca (strain DW4/3-1)
O30875 2.9e-09 50 40 0 64 3 cspA Major cold shock protein Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
P72188 3.12e-09 50 40 0 62 2 capA Cold shock protein CapA (Fragment) Pseudomonas fragi
P9WP75 3.14e-09 50 35 0 64 1 cspA Probable cold shock protein A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP74 3.14e-09 50 35 0 64 3 cspA Probable cold shock protein A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63849 3.14e-09 50 35 0 64 3 cspA Probable cold shock protein A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q45099 3.9e-09 50 39 1 64 1 cspD Cold shock-like protein CspD Bacillus cereus
O67327 3.96e-09 50 40 0 61 3 csp Cold shock-like protein Aquifex aeolicus (strain VF5)
A0R5E1 4.12e-09 50 35 0 64 1 cspA Probable cold shock protein A Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P46449 4.78e-09 50 35 0 65 3 cspD Cold shock-like protein CspD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q62764 5.22e-09 53 36 1 68 1 Ybx3 Y-box-binding protein 3 Rattus norvegicus
Q9JKB3 5.22e-09 53 36 1 68 1 Ybx3 Y-box-binding protein 3 Mus musculus
P16989 6.02e-09 53 36 1 68 1 YBX3 Y-box-binding protein 3 Homo sapiens
Q816H3 6.03e-09 50 37 1 64 3 cspD Cold shock-like protein CspD Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81K90 6.03e-09 50 37 1 64 3 cspD Cold shock-like protein CspD Bacillus anthracis
B5DE31 7.24e-09 53 36 1 68 1 ybx1 Y-box-binding protein 1 Danio rerio
P95459 7.53e-09 50 40 1 61 2 cspA Major cold shock protein CspA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A105 1.17e-08 49 38 1 63 3 capB Cold shock protein CapB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P0A106 1.17e-08 49 38 1 63 1 capB Cold shock protein CapB Pseudomonas fragi
Q81GQ6 1.19e-08 49 41 1 62 3 cspA Major cold shock protein CspA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81TW8 1.19e-08 49 41 1 62 3 cspA Major cold shock protein CspA Bacillus anthracis
Q9Z3S6 1.34e-08 49 34 1 64 2 cspA Cold shock protein CspA Rhizobium meliloti (strain 1021)
P71478 1.46e-08 49 40 1 65 2 csp Cold shock protein 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9Y2T7 2.23e-08 52 35 1 68 1 YBX2 Y-box-binding protein 2 Homo sapiens
Q81DK5 2.36e-08 48 40 2 69 3 cspE Cold shock-like protein CspE Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q45096 2.39e-08 48 41 1 62 1 cspA Major cold shock protein CspA Bacillus cereus
P0A357 2.58e-08 48 37 1 64 3 cspLB Cold shock-like protein CspLB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A358 2.58e-08 48 37 1 64 3 cspLB Cold shock-like protein CspLB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P32081 2.85e-08 48 39 1 61 1 cspB Cold shock protein CspB Bacillus subtilis (strain 168)
Q00436 2.98e-08 51 36 1 68 2 None B box-binding protein Xenopus laevis
P41824 3.02e-08 51 37 1 67 2 None Y-box factor homolog Aplysia californica
P21574 3.07e-08 51 37 1 67 1 ybx2-a Y-box-binding protein 2-A Xenopus laevis
Q9Z2C8 3.17e-08 51 35 1 68 1 Ybx2 Y-box-binding protein 2 Mus musculus
P39158 3.65e-08 48 40 1 64 1 cspC Cold shock protein CspC Bacillus subtilis (strain 168)
P45441 3.93e-08 51 37 1 67 1 ybx2-b Y-box-binding protein 2-B Xenopus laevis
P21573 4.11e-08 51 36 1 68 2 ybx1 Y-box-binding protein 1 Xenopus laevis
Q28618 4.21e-08 51 36 1 68 1 YBX1 Y-box-binding protein 1 Oryctolagus cuniculus
P27484 4.83e-08 50 38 1 68 2 GRP-2 Glycine-rich protein 2 Nicotiana sylvestris
P72192 5.46e-08 47 37 1 62 2 tapB Temperature acclimation protein B (Fragment) Pseudomonas fragi
P62961 5.59e-08 50 36 1 68 2 Ybx1 Y-box-binding protein 1 Rattus norvegicus
P62960 5.59e-08 50 36 1 68 1 Ybx1 Y-box-binding protein 1 Mus musculus
P67809 5.6e-08 50 36 1 68 1 YBX1 Y-box-binding protein 1 Homo sapiens
P67808 5.6e-08 50 36 1 68 2 YBX1 Y-box-binding protein 1 Bos taurus
Q06066 5.87e-08 50 36 1 68 2 YBX1 Y-box-binding protein 1 Gallus gallus
Q9KL16 1.18e-07 47 35 0 62 2 cspV Cold shock protein CspV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q81QK2 2.47e-07 46 39 2 69 3 cspE Cold shock-like protein CspE Bacillus anthracis
Q45100 2.54e-07 45 44 2 56 1 cspE Cold shock-like protein CspE (Fragment) Bacillus cereus
Q9KSW4 4.14e-07 45 32 0 65 3 cspD Cold shock-like protein CspD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A355 5.71e-07 45 39 1 64 1 cspLA Cold shock-like protein CspLA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A356 5.71e-07 45 39 1 64 3 cspLA Cold shock-like protein CspLA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P0A971 6.32e-07 45 32 0 65 3 cspD Cold shock-like protein CspD Shigella flexneri
P0A968 6.32e-07 45 32 0 65 1 cspD Cold shock-like protein CspD Escherichia coli (strain K12)
P0A969 6.32e-07 45 32 0 65 3 cspD Cold shock-like protein CspD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A970 6.32e-07 45 32 0 65 3 cspD Cold shock-like protein CspD Escherichia coli O157:H7
P54584 6.59e-07 45 34 0 64 2 csp Cold shock protein Arthrobacter globiformis
Q5X9L4 9.23e-07 44 35 1 64 3 cspA Major cold shock protein Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P41018 1.22e-06 43 36 1 58 3 cspB Cold shock protein CspB (Fragment) Sporosarcina globispora
Q38896 1.23e-06 46 39 0 51 1 CSP4 Cold shock domain-containing protein 4 Arabidopsis thaliana
O65639 1.32e-06 47 34 0 55 1 CSP1 Cold shock protein 1 Arabidopsis thaliana
P0DA49 2.28e-06 43 35 1 64 3 cspA Major cold shock protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0A361 2.28e-06 43 35 1 64 3 cspA Major cold shock protein Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DA48 2.28e-06 43 35 1 64 3 cspA Major cold shock protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0F1 2.28e-06 43 35 1 64 3 cspA Major cold shock protein Streptococcus pyogenes serotype M1
Q94C69 3.32e-06 45 34 0 50 1 CSP3 Cold shock domain-containing protein 3 Arabidopsis thaliana
P96349 4.84e-06 42 35 1 64 2 cspL Cold shock protein 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9H9Z2 7.9e-06 44 34 1 70 1 LIN28A Protein lin-28 homolog A Homo sapiens
Q8K3Y3 1.22e-05 43 34 1 70 1 Lin28a Protein lin-28 homolog A Mus musculus
P55390 1.44e-05 41 33 0 51 4 NGR_a00060 Probable cold shock protein y4cH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8JHC4 1.47e-05 43 32 2 70 2 lin28a Protein lin-28 homolog A Xenopus laevis
P0A1D9 1.9e-05 41 39 0 61 3 cspH Cold shock-like protein CspH Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1E0 1.9e-05 41 39 0 61 3 cspH Cold shock-like protein CspH Salmonella typhi
Q44317 2.06e-05 40 43 0 41 3 cspA Major cold-shock protein (Fragment) Aeromonas salmonicida
Q5EB47 2.33e-05 43 32 2 70 2 lin28a Protein lin-28 homolog A Xenopus tropicalis
P48859 2.37e-05 40 29 0 64 2 scoF Cold shock protein ScoF Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q01761 2.48e-05 40 35 1 64 1 SC7.0 Cold shock-like protein 7.0 Streptomyces clavuligerus
Q56922 3.56e-05 40 43 0 41 3 cspA Major cold shock protein (Fragment) Yersinia enterocolitica
Q48493 3.84e-05 40 41 0 41 3 cspA Major cold shock protein (Fragment) Klebsiella pneumoniae
Q1RHK6 4.21e-05 40 35 1 56 3 cspA Cold shock-like protein CspA Rickettsia bellii (strain RML369-C)
Q92GV1 4.49e-05 40 36 0 50 3 cspA Cold shock-like protein CspA Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZCP9 6.5e-05 40 36 0 50 3 cspA Cold shock-like protein CspA Rickettsia prowazekii (strain Madrid E)
Q53816 7.24e-05 39 41 0 41 3 cspA Major cold shock protein (Fragment) Shigella boydii
Q56178 7.24e-05 39 41 0 41 3 cspA Major cold shock protein (Fragment) Salmonella virchow
Q46051 7.24e-05 39 41 0 41 3 cspA Major cold shock protein (Fragment) Citrobacter freundii
Q6ZN17 8.59e-05 41 31 1 70 1 LIN28B Protein lin-28 homolog B Homo sapiens
P0A352 0.00011 39 31 0 64 3 cspA Cold shock-like protein CspA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A354 0.00011 39 31 0 64 3 cspA Cold shock-like protein CspA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A353 0.00011 39 31 0 64 3 cspA Cold shock-like protein CspA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q45KJ4 0.000125 41 31 1 70 2 LIN28B Protein lin-28 homolog B Gallus gallus
Q45KJ6 0.000136 41 31 2 70 1 Lin28b Protein lin-28 homolog B Mus musculus
Q41188 0.000188 40 37 0 43 1 CSP2 Cold shock protein 2 Arabidopsis thaliana
Q803L0 0.000195 40 28 1 70 1 lin28a Protein lin-28 homolog A Danio rerio
Q44078 0.000202 38 41 0 41 3 cspA Major cold-shock protein (Fragment) Aeromonas hydrophila
Q45KJ5 0.000367 39 32 2 70 2 LIN28A Protein lin-28 homolog A Gallus gallus
Q8AVK2 0.000471 39 30 1 73 2 lin28b Protein lin-28 homolog B (Fragment) Xenopus laevis
Q4UMU5 0.000527 37 34 0 50 3 cspA Cold shock-like protein CspA Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q61CX7 0.000694 39 27 0 55 3 lin-28 Protein lin-28 Caenorhabditis briggsae
Q68W69 0.000841 37 34 0 50 3 cspA Cold shock-like protein CspA Rickettsia typhi (strain ATCC VR-144 / Wilmington)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03540
Feature type CDS
Gene -
Product cold shock domain-containing protein
Location 791810 - 792025 (strand: 1)
Length 216 (nucleotides) / 71 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_398
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00313 'Cold-shock' DNA-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1278 Transcription (K) K Cold shock protein, CspA family

Protein Sequence

MTLQLRMGRVKWFDNNKGYGLIVAKDLEQDIYVNKKAIANTKNKALTEGQDVEFSVIKTAAGLEAADVIGF

Flanking regions ( +/- flanking 50bp)

TGTGTATAGAAGATAAAAACTATACAAAGAACAAAAGGAGTTTATCTATCATGACATTACAATTAAGAATGGGTCGCGTAAAATGGTTTGACAATAATAAAGGATATGGTCTTATTGTTGCAAAAGATCTTGAACAAGATATTTACGTCAATAAAAAAGCGATTGCCAATACAAAAAATAAAGCACTAACCGAAGGCCAAGACGTTGAGTTTTCTGTTATCAAAACAGCAGCAGGTCTAGAAGCCGCTGATGTTATCGGGTTCTAAATAGTCGACACCTATAATAAATGGGTAAGACCATGTTTTAACCTATTGAT