Homologs in group_1218

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07090 FBDBKF_07090 85.5 Morganella morganii S1 trxB thioredoxin-disulfide reductase
EHELCC_03880 EHELCC_03880 85.5 Morganella morganii S2 trxB thioredoxin-disulfide reductase
NLDBIP_03880 NLDBIP_03880 85.5 Morganella morganii S4 trxB thioredoxin-disulfide reductase
LHKJJB_09710 LHKJJB_09710 85.5 Morganella morganii S3 trxB thioredoxin-disulfide reductase
HKOGLL_09265 HKOGLL_09265 85.5 Morganella morganii S5 trxB thioredoxin-disulfide reductase
F4V73_RS01275 F4V73_RS01275 83.7 Morganella psychrotolerans trxB thioredoxin-disulfide reductase

Distribution of the homologs in the orthogroup group_1218

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1218

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9KSS4 0.0 563 84 0 315 3 trxB Thioredoxin reductase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A9P4 0.0 558 85 1 317 1 trxB Thioredoxin reductase Escherichia coli (strain K12)
P0A9P5 0.0 558 85 1 317 3 trxB Thioredoxin reductase Escherichia coli O157:H7
P43788 0.0 524 78 0 315 1 trxB Thioredoxin reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q93HX6 1.54e-169 476 71 1 318 1 None Glucosaminate ammonia-lyase Pseudomonas fluorescens
P39916 1.38e-158 448 66 1 317 3 trxB Thioredoxin reductase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P81433 1.01e-145 416 59 1 318 3 trxB Thioredoxin reductase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AJ2 2.39e-134 387 59 4 314 3 trxB Thioredoxin reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57399 4.36e-134 386 56 1 318 3 trxB Thioredoxin reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q92I02 9.97e-122 354 54 5 312 3 trxB Thioredoxin reductase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RJD8 1.38e-121 354 54 5 312 3 trxB Thioredoxin reductase Rickettsia bellii (strain RML369-C)
Q4ULP1 8.13e-120 350 54 5 312 3 trxB Thioredoxin reductase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZD97 5.51e-116 340 51 5 312 3 trxB Thioredoxin reductase Rickettsia prowazekii (strain Madrid E)
Q68WT3 6.64e-114 335 51 5 312 3 trxB Thioredoxin reductase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
O30973 1.34e-102 306 50 7 308 3 trxB Thioredoxin reductase Mycolicibacterium smegmatis
P51978 2.55e-99 298 49 7 320 3 cys-9 Thioredoxin reductase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q70G58 5.36e-98 301 48 6 315 1 Os07g0657900 Thioredoxin reductase NTRC Oryza sativa subsp. japonica
P38816 1e-97 295 48 6 327 1 TRR2 Thioredoxin reductase 2, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6FR39 1.69e-97 293 48 8 328 3 TRR1 Thioredoxin reductase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O84101 1.76e-97 293 47 7 319 3 trxB Thioredoxin reductase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O22229 3.86e-97 299 48 6 315 1 NTRC NADPH-dependent thioredoxin reductase 3 Arabidopsis thaliana
Q05741 6.51e-97 292 49 8 326 1 trxB Thioredoxin reductase Streptomyces clavuligerus
P29509 1.47e-96 291 47 6 324 1 TRR1 Thioredoxin reductase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9PKT7 1.3e-95 288 47 7 319 3 trxB Thioredoxin reductase Chlamydia muridarum (strain MoPn / Nigg)
P9WHH1 2.64e-95 288 48 6 308 1 trxB Thioredoxin reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHH0 2.64e-95 288 48 6 308 3 trxB Thioredoxin reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q75CM8 3.53e-95 287 47 6 324 3 TRR1 Thioredoxin reductase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q9Z8M4 6.95e-95 286 48 8 319 3 trxB Thioredoxin reductase Chlamydia pneumoniae
Q54UU8 7.68e-94 284 47 7 327 3 trrA Thioredoxin reductase Dictyostelium discoideum
P52215 2.2e-93 283 47 8 320 2 trxB Thioredoxin reductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6HA24 1.05e-92 282 47 8 325 3 TRR1 Thioredoxin reductase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P46843 1.38e-92 285 48 6 309 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
Q6BIS1 6.28e-92 279 46 6 320 3 TRR1 Thioredoxin reductase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q6C7L4 4.85e-91 277 45 6 322 3 TRR1 Thioredoxin reductase Yarrowia lipolytica (strain CLIB 122 / E 150)
P43496 3.21e-90 275 45 7 326 1 TRR1 Thioredoxin reductase Penicillium chrysogenum
Q92375 5.07e-90 274 44 6 326 1 trr1 Thioredoxin reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q39242 7.48e-90 276 44 7 327 2 NTR2 Thioredoxin reductase 2 Arabidopsis thaliana
Q8J0U0 5.34e-89 272 45 7 311 2 TRR1 Thioredoxin reductase Pneumocystis jirovecii
Q7Z7S3 7.01e-89 271 45 6 311 2 TRR1 Thioredoxin reductase Pneumocystis carinii
Q39243 4.03e-83 258 45 8 331 1 NTR1 Thioredoxin reductase 1, mitochondrial Arabidopsis thaliana
Q6ZFU6 4.24e-83 257 46 6 317 2 NTRB Thioredoxin reductase NTRB Oryza sativa subsp. japonica
Q69PS6 9.33e-78 244 47 6 318 3 Os06g0327300 Thioredoxin reductase NTRA Oryza sativa subsp. japonica
Q8T6Z1 8.9e-76 237 44 7 308 2 TRXB Thioredoxin reductase (Fragment) Spironucleus barkhanus
P66011 4.23e-72 228 43 4 309 1 trxB Thioredoxin reductase Staphylococcus aureus (strain MW2)
Q6GB66 4.23e-72 228 43 4 309 3 trxB Thioredoxin reductase Staphylococcus aureus (strain MSSA476)
P99101 4.23e-72 228 43 4 309 1 trxB Thioredoxin reductase Staphylococcus aureus (strain N315)
P66010 4.23e-72 228 43 4 309 3 trxB Thioredoxin reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHQ4 4.23e-72 228 43 4 309 3 trxB Thioredoxin reductase Staphylococcus aureus (strain COL)
Q8CPY8 4.38e-72 228 43 4 310 3 trxB Thioredoxin reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQW4 4.38e-72 228 43 4 310 3 trxB Thioredoxin reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6GIM7 1.71e-71 226 43 4 309 3 trxB Thioredoxin reductase Staphylococcus aureus (strain MRSA252)
P80880 2.81e-70 224 40 7 320 1 trxB Thioredoxin reductase Bacillus subtilis (strain 168)
P50971 9.24e-66 212 39 5 314 1 trxB Thioredoxin reductase Peptoclostridium acidaminophilum
O32823 5.77e-65 210 38 6 313 3 trxB Thioredoxin reductase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q928B5 5.09e-64 207 39 7 310 3 trxB Thioredoxin reductase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P52213 4.46e-63 205 38 5 315 3 trxB Thioredoxin reductase Peptoclostridium litorale
Q9ZL18 1.12e-62 204 37 6 311 3 trxB Thioredoxin reductase Helicobacter pylori (strain J99 / ATCC 700824)
P56431 3.43e-62 202 36 6 311 1 trxB Thioredoxin reductase Helicobacter pylori (strain ATCC 700392 / 26695)
P94284 1.16e-60 199 36 6 307 3 trxB Thioredoxin reductase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P23160 1.92e-58 193 35 6 315 3 None 34.2 kDa protein in rubredoxin operon Clostridium pasteurianum
O83790 2.55e-57 190 37 3 295 3 trxB Thioredoxin reductase Treponema pallidum (strain Nichols)
P47348 1.73e-52 178 37 8 302 3 trxB Thioredoxin reductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q58931 5.36e-52 176 35 10 310 3 MJ1536 Putative thioredoxin reductase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O66790 2.88e-47 164 35 7 311 3 trxB Thioredoxin reductase Aquifex aeolicus (strain VF5)
Q9PR71 8.65e-46 160 34 7 313 3 trxB Thioredoxin reductase Ureaplasma parvum serovar 3 (strain ATCC 700970)
P75531 4.91e-43 153 35 7 287 3 trxB Thioredoxin reductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q98PK9 9.05e-41 147 33 10 315 3 trxB Thioredoxin reductase Mycoplasmopsis pulmonis (strain UAB CTIP)
P26829 7.6e-39 146 31 9 309 1 ahpF NADH dehydrogenase Ferdinandcohnia aciditolerans (strain JCM 32973 / CCTCC AB 2017280 / YN-1)
P0A156 2.09e-37 142 34 7 279 3 ahpF Alkyl hydroperoxide reductase subunit F Pseudomonas putida
P0A155 2.09e-37 142 34 7 279 3 ahpF Alkyl hydroperoxide reductase subunit F Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O06465 1.24e-35 138 32 7 286 3 ahpF Alkyl hydroperoxide reductase subunit F Xanthomonas campestris pv. phaseoli
Q6GC92 9.29e-35 135 31 8 301 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain MSSA476)
P66013 1.07e-34 135 31 8 301 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain MW2)
P99118 1.07e-34 135 31 8 301 1 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain N315)
P66012 1.07e-34 135 31 8 301 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIR6 1.41e-34 134 31 8 301 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain COL)
O05204 1.41e-34 134 31 8 301 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GJR8 4.13e-34 133 31 8 301 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain MRSA252)
Q8CMQ1 7.94e-34 132 31 9 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRY2 7.94e-34 132 31 9 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P35340 1.37e-33 132 31 8 300 1 ahpF Alkyl hydroperoxide reductase subunit F Escherichia coli (strain K12)
Q9I6Z2 3.34e-33 131 32 8 282 3 ahpF Alkyl hydroperoxide reductase subunit F Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P19480 4.98e-33 130 32 8 297 1 ahpF Alkyl hydroperoxide reductase subunit F Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42974 1.07e-30 124 30 8 296 1 ahpF NADH dehydrogenase Bacillus subtilis (strain 168)
Q9CF34 3.3e-27 111 27 9 303 3 LL1647 Ferredoxin--NADP reductase Lactococcus lactis subsp. lactis (strain IL1403)
Q02XL9 3.69e-27 111 27 7 302 3 LACR_1811 Ferredoxin--NADP reductase Lactococcus lactis subsp. cremoris (strain SK11)
A2RJC6 6.83e-27 110 27 7 302 3 llmg_0776 Ferredoxin--NADP reductase Lactococcus lactis subsp. cremoris (strain MG1363)
Q72LG3 4.13e-25 106 30 11 310 3 TT_C0096 Ferredoxin--NADP reductase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B2GEF7 1.3e-24 104 30 12 310 3 LAF_1703 Ferredoxin--NADP reductase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q5SL28 1.67e-24 104 30 11 310 1 TTHA0465 Ferredoxin--NADP reductase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5WDV1 6.05e-24 102 29 11 324 3 ABC2925 Ferredoxin--NADP reductase 2 Shouchella clausii (strain KSM-K16)
Q8Y4P5 6.52e-24 102 27 10 304 3 lmo2390 Ferredoxin--NADP reductase 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q928P3 7.66e-24 102 27 10 304 3 lin2489 Ferredoxin--NADP reductase 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AL74 1.1e-23 102 27 10 304 3 lwe2338 Ferredoxin--NADP reductase 2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q71X35 1.24e-23 102 27 10 304 3 LMOf2365_2364 Ferredoxin--NADP reductase 2 Listeria monocytogenes serotype 4b (strain F2365)
Q8ENX4 2.17e-21 95 29 13 317 3 OB2351 Ferredoxin--NADP reductase 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B2G9D0 5.14e-21 95 29 11 323 3 LAR_1546 Ferredoxin--NADP reductase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VM22 5.14e-21 95 29 11 323 3 Lreu_1657 Ferredoxin--NADP reductase Limosilactobacillus reuteri (strain DSM 20016)
A4YER6 2.17e-20 93 28 13 324 3 Msed_0743 Ferredoxin--NADP reductase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q89HV6 2.93e-20 92 26 14 331 3 bll5883 Ferredoxin--NADP reductase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A4ISE6 7.78e-20 91 25 10 316 3 GTNG_2905 Ferredoxin--NADP reductase Geobacillus thermodenitrificans (strain NG80-2)
A8FH11 9.97e-20 91 27 12 318 3 BPUM_2873 Ferredoxin--NADP reductase 2 Bacillus pumilus (strain SAFR-032)
A0LXL9 1.17e-19 91 27 11 293 3 GFO_0125 Ferredoxin--NADP reductase 1 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
B3QJ15 2.15e-19 90 27 16 329 3 Rpal_4475 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain TIE-1)
Q6N2U4 2.15e-19 90 27 16 329 1 RPA3954 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5WAF1 3.43e-19 90 27 12 322 3 ABC0094 Ferredoxin--NADP reductase 1 Shouchella clausii (strain KSM-K16)
Q6L1Y6 3.55e-19 89 27 11 291 3 PTO0431 Ferredoxin--NADP reductase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q13AK7 4.49e-19 89 25 15 331 3 RPD_1645 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain BisB5)
Q82ZZ8 4.81e-19 89 27 10 307 3 EF_2899 Ferredoxin--NADP reductase Enterococcus faecalis (strain ATCC 700802 / V583)
Q97WJ5 5.82e-19 89 28 10 291 3 SSO2222 Ferredoxin--NADP reductase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A5EMW5 8.83e-19 89 26 14 327 3 BBta_5550 Ferredoxin--NADP reductase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4YXZ8 2.26e-18 87 26 14 327 3 BRADO5079 Ferredoxin--NADP reductase Bradyrhizobium sp. (strain ORS 278)
B3QXR3 2.28e-18 87 27 14 313 3 Ctha_2529 Ferredoxin--NADP reductase 2 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q2ITC6 2.37e-18 87 26 16 331 3 RPB_3841 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain HaA2)
A3CM39 2.4e-18 87 25 10 303 3 SSA_0813 Ferredoxin--NADP reductase Streptococcus sanguinis (strain SK36)
B5E6K6 2.65e-18 87 26 11 317 3 SPG_1489 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 19F (strain G54)
A7Z8C1 3.24e-18 87 26 12 318 3 RBAM_029160 Ferredoxin--NADP reductase 2 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B1YKW2 4.34e-18 86 27 13 306 3 Exig_2313 Ferredoxin--NADP reductase 1 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q4JCM0 4.59e-18 86 26 13 328 3 Saci_0029 Ferredoxin--NADP reductase 1 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
O05268 4.8e-18 86 26 12 318 1 yumC Ferredoxin--NADP reductase 2 Bacillus subtilis (strain 168)
Q219B6 7e-18 86 26 14 330 3 RPC_1458 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain BisB18)
Q8DP13 7.94e-18 85 26 11 317 3 spr1421 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04JI5 7.94e-18 85 26 11 317 3 SPD_1393 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9K7F3 9.49e-18 85 26 10 320 3 BH3408 Ferredoxin--NADP reductase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8DUN5 1.02e-17 85 27 9 305 3 SMU_869 Ferredoxin--NADP reductase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B1ICY3 1.08e-17 85 25 11 317 3 SPH_1677 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain Hungary19A-6)
Q5KVP7 1.45e-17 85 25 11 316 3 GK2954 Ferredoxin--NADP reductase Geobacillus kaustophilus (strain HTA426)
Q8DYW9 2.01e-17 84 26 8 304 3 SAG1353 Ferredoxin--NADP reductase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E4H8 2.01e-17 84 26 8 304 3 gbs1423 Ferredoxin--NADP reductase Streptococcus agalactiae serotype III (strain NEM316)
Q3K0F9 2.01e-17 84 26 8 304 3 SAK_1384 Ferredoxin--NADP reductase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B2IR81 2.86e-17 84 26 12 319 3 SPCG_1548 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain CGSP14)
Q97PP0 2.86e-17 84 26 12 319 3 SP_1563 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A8AXQ6 3.38e-17 84 25 10 303 3 SGO_1284 Ferredoxin--NADP reductase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B4U394 3.82e-17 84 26 8 304 3 Sez_1109 Ferredoxin--NADP reductase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q07RK6 3.87e-17 84 25 15 331 3 RPE_1478 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain BisA53)
Q96YN9 4.79e-17 84 26 11 320 3 STK_21330 Ferredoxin--NADP reductase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P80892 4.88e-17 76 83 0 42 1 trxB Thioredoxin reductase (Fragment) Aliivibrio fischeri
A0LY71 5.66e-17 84 28 11 294 3 GFO_0330 Ferredoxin--NADP reductase 2 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A0LT79 8.71e-17 82 28 13 316 3 Acel_0866 Ferredoxin--NADP reductase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q3STP0 8.99e-17 83 24 15 333 3 Nwi_1089 Ferredoxin--NADP reductase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q03JS2 1.18e-16 82 25 9 313 3 STER_1382 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M3J6 1.18e-16 82 25 9 313 3 stu1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYY3 1.18e-16 82 25 9 313 3 str1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain CNRZ 1066)
Q65FE0 6.11e-16 80 25 12 318 3 BLi03393 Ferredoxin--NADP reductase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A9NFF6 6.67e-16 80 25 11 314 3 ACL_0467 Ferredoxin--NADP reductase Acholeplasma laidlawii (strain PG-8A)
B5XKX5 7.49e-16 80 28 9 293 3 Spy49_0668 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M49 (strain NZ131)
Q1JHF5 9.17e-16 80 28 9 293 3 MGAS10270_Spy0716 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M2 (strain MGAS10270)
A2RF47 1.09e-15 79 28 9 293 3 SpyM51151 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J776 1.09e-15 79 29 9 293 3 MGAS10750_Spy0748 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JMB2 1.09e-15 79 28 9 293 3 MGAS9429_Spy0712 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCC9 1.09e-15 79 28 9 293 3 MGAS2096_Spy0727 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8P1F2 1.09e-15 79 28 9 293 3 spyM18_0909 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCQ2 1.09e-15 79 28 9 293 3 M6_Spy0676 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q67QU3 1.15e-15 79 26 13 321 3 STH965 Ferredoxin--NADP reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P0DB07 1.2e-15 79 28 9 293 3 SPs1279 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB06 1.2e-15 79 28 9 293 3 SpyM3_0575 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48U54 1.24e-15 79 28 9 293 3 M28_Spy0638 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q4FMZ1 1.24e-15 79 24 13 316 3 SAR11_0627 Ferredoxin--NADP reductase Pelagibacter ubique (strain HTCC1062)
B2U9D2 1.27e-15 80 26 13 337 3 Rpic_0981 Ferredoxin--NADP reductase Ralstonia pickettii (strain 12J)
Q1QNQ1 1.65e-15 79 23 14 331 3 Nham_1321 Ferredoxin--NADP reductase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q9A0B5 1.67e-15 79 28 9 293 3 SPy_0850 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M1
B3QXE1 1.7e-15 79 25 14 320 3 Ctha_0950 Ferredoxin--NADP reductase 1 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q4J6Z4 2.09e-15 79 25 12 309 3 Saci_2144 Ferredoxin--NADP reductase 2 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q0RRX8 3.61e-15 78 27 13 310 3 FRAAL1022 Ferredoxin--NADP reductase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A6H064 6.54e-15 77 29 13 296 3 FP1670 Ferredoxin--NADP reductase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
B1HW35 8.33e-15 77 24 12 294 3 Bsph_2322 Ferredoxin--NADP reductase 3 Lysinibacillus sphaericus (strain C3-41)
Q03PJ4 1.6e-14 76 27 11 311 3 LVIS_1813 Ferredoxin--NADP reductase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A4F891 3.65e-14 75 29 12 310 3 SACE_0932 Ferredoxin--NADP reductase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q03AW0 5.28e-14 75 25 11 312 3 LSEI_0826 Ferredoxin--NADP reductase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A5FJT9 5.81e-14 75 27 12 294 3 Fjoh_1507 Ferredoxin--NADP reductase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B3WCB2 6.7e-14 74 25 11 312 3 LCABL_08900 Ferredoxin--NADP reductase Lacticaseibacillus casei (strain BL23)
B1YEQ1 7.82e-14 74 23 13 302 3 Exig_2773 Ferredoxin--NADP reductase 2 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q6HP49 1.05e-13 74 25 13 296 3 BT9727_0321 Ferredoxin--NADP reductase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81ZB7 1.05e-13 74 25 13 296 3 BA_0352 Ferredoxin--NADP reductase 1 Bacillus anthracis
A0R951 1.05e-13 74 25 13 296 3 BALH_0343 Ferredoxin--NADP reductase 1 Bacillus thuringiensis (strain Al Hakam)
Q2JFM8 1.13e-13 73 26 13 304 3 Francci3_0530 Ferredoxin--NADP reductase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q98M06 1.6e-13 73 24 12 304 3 mll0792 Ferredoxin--NADP reductase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B1HZ05 1.78e-13 73 25 11 291 3 Bsph_0789 Ferredoxin--NADP reductase 1 Lysinibacillus sphaericus (strain C3-41)
Q8Y0A5 1.8e-13 73 25 12 331 3 RSc1139 Ferredoxin--NADP reductase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q73EA6 2.36e-13 73 24 13 296 3 BCE_0452 Ferredoxin--NADP reductase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
B1I067 3.18e-13 72 25 11 315 3 Bsph_0993 Ferredoxin--NADP reductase 2 Lysinibacillus sphaericus (strain C3-41)
A4VXW3 3.18e-13 72 24 10 318 3 SSU05_1986 Ferredoxin--NADP reductase Streptococcus suis (strain 05ZYH33)
A4W460 3.18e-13 72 24 10 318 3 SSU98_1991 Ferredoxin--NADP reductase Streptococcus suis (strain 98HAH33)
Q38YJ1 3.3e-13 72 25 10 304 3 LCA_0435 Ferredoxin--NADP reductase 2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q71Y53 3.84e-13 72 23 11 325 3 LMOf2365_1991 Ferredoxin--NADP reductase 1 Listeria monocytogenes serotype 4b (strain F2365)
B4SFQ3 4.12e-13 72 26 17 326 3 Ppha_1024 Ferredoxin--NADP reductase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
O31475 4.87e-13 72 24 14 325 1 ycgT Ferredoxin--NADP reductase 1 Bacillus subtilis (strain 168)
Q049B3 5.62e-13 71 26 13 308 3 LBUL_1466 Ferredoxin--NADP reductase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G967 5.62e-13 71 26 13 308 3 Ldb1586 Ferredoxin--NADP reductase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A9VRK8 6.26e-13 72 24 13 296 3 BcerKBAB4_0332 Ferredoxin--NADP reductase 1 Bacillus mycoides (strain KBAB4)
Q1WUT6 6.31e-13 72 24 10 296 3 LSL_0439 Ferredoxin--NADP reductase Ligilactobacillus salivarius (strain UCC118)
B2IHR5 7.33e-13 71 25 14 326 3 Bind_2345 Ferredoxin--NADP reductase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B3R4A7 7.82e-13 71 24 10 317 3 RALTA_A1176 Ferredoxin--NADP reductase 1 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q65GY3 9.55e-13 71 25 13 323 3 BLi02810 Ferredoxin--NADP reductase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8Y5U4 1.11e-12 71 23 11 327 3 lmo1961 Ferredoxin--NADP reductase 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q0KCD1 1.21e-12 71 23 10 324 3 H16_A1199 Ferredoxin--NADP reductase 1 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9ZD33 1.57e-12 70 26 12 313 3 RP514 Ferredoxin--NADP reductase Rickettsia prowazekii (strain Madrid E)
A8YTT2 1.62e-12 70 27 16 311 3 lhv_0465 Ferredoxin--NADP reductase Lactobacillus helveticus (strain DPC 4571)
Q8ETS1 1.76e-12 70 23 13 326 3 OB0186 Ferredoxin--NADP reductase 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q68WM0 2.27e-12 70 26 12 309 3 RT0500 Ferredoxin--NADP reductase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A7GUD5 2.37e-12 70 25 12 318 3 Bcer98_3539 Ferredoxin--NADP reductase 2 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A5CF57 3.03e-12 69 23 10 292 3 OTBS_1841 Ferredoxin--NADP reductase Orientia tsutsugamushi (strain Boryong)
A8AA47 3.08e-12 69 26 11 313 3 Igni_0617 Ferredoxin--NADP reductase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
A4JS50 3.14e-12 70 26 12 314 3 Bcep1808_6193 Ferredoxin--NADP reductase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q74KS6 3.44e-12 69 25 13 307 3 LJ_0501 Ferredoxin--NADP reductase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A8GW75 3.45e-12 69 24 12 304 3 A1I_03745 Ferredoxin--NADP reductase Rickettsia bellii (strain OSU 85-389)
Q473F6 3.55e-12 69 23 10 315 3 Reut_A1099 Ferredoxin--NADP reductase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q045M0 4.16e-12 69 26 17 319 3 LGAS_0447 Ferredoxin--NADP reductase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q03ZE9 4.91e-12 69 24 9 316 3 LEUM_0297 Ferredoxin--NADP reductase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A0AK73 5.31e-12 68 22 11 323 3 lwe1987 Ferredoxin--NADP reductase 1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A8M2W8 5.62e-12 68 26 13 314 3 Sare_0817 Ferredoxin--NADP reductase Salinispora arenicola (strain CNS-205)
B1MX70 7e-12 68 24 8 315 3 LCK_00289 Ferredoxin--NADP reductase Leuconostoc citreum (strain KM20)
Q1RHV1 7.3e-12 68 25 13 305 3 RBE_0982 Ferredoxin--NADP reductase Rickettsia bellii (strain RML369-C)
Q816D9 8.04e-12 68 24 12 317 1 BC_4926 Ferredoxin--NADP reductase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B3CTT3 8.39e-12 68 23 10 294 3 OTT_1322 Ferredoxin--NADP reductase Orientia tsutsugamushi (strain Ikeda)
Q632D6 9.08e-12 68 24 12 317 3 BCE33L4658 Ferredoxin--NADP reductase Bacillus cereus (strain ZK / E33L)
Q6HBX6 9.08e-12 68 24 12 317 3 BT9727_4639 Ferredoxin--NADP reductase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q72YF6 9.08e-12 68 24 12 317 3 BCE_5065 Ferredoxin--NADP reductase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81XS0 9.08e-12 68 24 12 317 3 BA_5160 Ferredoxin--NADP reductase 2 Bacillus anthracis
A0RKB9 9.08e-12 68 24 12 317 3 BALH_4465 Ferredoxin--NADP reductase 2 Bacillus thuringiensis (strain Al Hakam)
Q5FLU4 2.63e-11 67 27 12 291 3 LBA0439 Ferredoxin--NADP reductase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q3AS18 2.93e-11 67 25 12 309 3 Cag_0944 Ferredoxin--NADP reductase Chlorobium chlorochromatii (strain CaD3)
A9VMZ3 3.29e-11 66 24 12 317 3 BcerKBAB4_4748 Ferredoxin--NADP reductase 2 Bacillus mycoides (strain KBAB4)
Q4L8N5 3.33e-11 67 24 12 292 3 SH0681 Ferredoxin--NADP reductase Staphylococcus haemolyticus (strain JCSC1435)
Q2RNR2 3.86e-11 66 24 12 323 3 Rru_A3439 Ferredoxin--NADP reductase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A7GKN4 4.21e-11 66 22 12 297 3 Bcer98_0331 Ferredoxin--NADP reductase 1 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q92A47 7.45e-11 65 22 12 325 3 lin2075 Ferredoxin--NADP reductase 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P43783 8.9e-11 65 28 10 207 3 gor Glutathione reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1LPH7 1.34e-10 65 23 10 317 3 Rmet_1063 Ferredoxin--NADP reductase 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q4ULM2 1.49e-10 64 25 12 305 3 RF_0700 Ferredoxin--NADP reductase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q2W0C9 1.64e-10 64 24 12 302 3 amb3892 Ferredoxin--NADP reductase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A8F1N2 1.66e-10 64 25 12 303 3 RMA_0647 Ferredoxin--NADP reductase Rickettsia massiliae (strain Mtu5)
Q3YS71 1.71e-10 64 22 6 285 3 Ecaj_0391 Ferredoxin--NADP reductase Ehrlichia canis (strain Jake)
B3CMJ8 1.72e-10 64 23 10 292 3 WP1010 Ferredoxin--NADP reductase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A4X398 2.25e-10 64 27 14 311 3 Strop_0871 Ferredoxin--NADP reductase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B0BXN8 2.52e-10 64 23 12 310 3 RrIowa_0762 Ferredoxin--NADP reductase Rickettsia rickettsii (strain Iowa)
Q7NBE9 2.67e-10 63 23 10 255 3 MYCGA3300 Ferredoxin--NADP reductase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B4S9F8 2.71e-10 64 24 11 308 3 Paes_1610 Ferredoxin--NADP reductase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A1SKI3 2.73e-10 63 24 14 313 3 Noca_2816 Ferredoxin--NADP reductase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q483W3 3.33e-10 63 25 13 292 3 CPS_1923 Ferredoxin--NADP reductase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A8GS72 3.71e-10 63 23 12 310 3 A1G_03605 Ferredoxin--NADP reductase Rickettsia rickettsii (strain Sheila Smith)
Q92HY3 3.96e-10 63 24 12 308 3 RC0637 Ferredoxin--NADP reductase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q5PAR7 4.68e-10 63 23 10 297 3 AM617 Ferredoxin--NADP reductase Anaplasma marginale (strain St. Maries)
A8GNK2 1.11e-09 62 28 5 180 3 A1C_03465 Ferredoxin--NADP reductase Rickettsia akari (strain Hartford)
Q73GH2 1.36e-09 62 22 10 292 3 WD_0982 Ferredoxin--NADP reductase Wolbachia pipientis wMel
A4SVT8 1.54e-09 62 24 11 289 3 Pnuc_0382 Ferredoxin--NADP reductase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q5HBC7 1.8e-09 61 22 11 298 3 Erum4020 Ferredoxin--NADP reductase Ehrlichia ruminantium (strain Welgevonden)
Q88UC0 2.49e-09 61 23 10 304 3 lp_2585 Ferredoxin--NADP reductase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q3B2Q8 2.77e-09 61 23 12 314 3 Plut_1516 Ferredoxin--NADP reductase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A1BHP4 3.06e-09 60 25 14 294 3 Cpha266_1905 Ferredoxin--NADP reductase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A7HW48 3.78e-09 60 24 13 300 3 Plav_2522 Ferredoxin--NADP reductase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A9H9C9 4.39e-09 60 25 12 309 3 GDI0711 Ferredoxin--NADP reductase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q4L4Y7 5.99e-09 60 30 10 200 3 cdr Coenzyme A disulfide reductase Staphylococcus haemolyticus (strain JCSC1435)
B2JN27 6.63e-09 60 23 10 308 3 Bphy_3740 Ferredoxin--NADP reductase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A8EYV4 7.9e-09 59 27 5 177 3 A1E_02985 Ferredoxin--NADP reductase Rickettsia canadensis (strain McKiel)
Q2GJY7 8.01e-09 59 24 11 296 3 APH_0734 Ferredoxin--NADP reductase Anaplasma phagocytophilum (strain HZ)
Q5FH31 8.27e-09 59 22 11 298 3 ERGA_CDS_04100 Ferredoxin--NADP reductase Ehrlichia ruminantium (strain Gardel)
P50970 1.04e-08 59 26 14 335 3 lpd Dihydrolipoyl dehydrogenase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q04HB6 1.48e-08 58 27 7 206 3 OEOE_0163 Ferredoxin--NADP reductase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q0BQJ9 1.72e-08 58 25 8 294 3 GbCGDNIH1_2006 Ferredoxin--NADP reductase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q5HHB4 2.93e-08 58 29 11 222 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain COL)
A7Z171 2.94e-08 57 23 11 317 3 RBAM_003480 Ferredoxin--NADP reductase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8Z076 2.96e-08 58 29 11 222 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain USA300 / TCH1516)
A6QFI1 2.96e-08 58 29 11 222 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Newman)
Q2FIA5 2.96e-08 58 29 11 222 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain USA300)
O52582 3.1e-08 58 28 7 204 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
A5IRE8 3.58e-08 58 28 9 207 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain JH9)
A6U077 3.58e-08 58 28 9 207 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain JH1)
Q8KCB2 3.76e-08 57 23 12 299 1 CT1512 Ferredoxin--NADP reductase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8NXE8 3.78e-08 57 29 9 206 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain MW2)
Q6GAV6 3.78e-08 57 29 9 206 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain MSSA476)
O62768 3.97e-08 58 25 6 202 2 TXNRD1 Thioredoxin reductase 1, cytoplasmic Bos taurus
B3QPZ8 4.14e-08 57 23 12 305 3 Cpar_1603 Ferredoxin--NADP reductase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q7A6H1 5.23e-08 57 28 9 206 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain N315)
Q99VC0 5.23e-08 57 28 9 206 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X0I7 5.23e-08 57 28 9 206 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2GGH5 6.98e-08 56 21 8 296 3 ECH_0649 Ferredoxin--NADP reductase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q03H60 8.36e-08 56 25 4 181 3 PEPE_0366 Ferredoxin--NADP reductase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B3EKW5 9.84e-08 56 23 10 297 3 Cphamn1_1733 Ferredoxin--NADP reductase Chlorobium phaeobacteroides (strain BS1)
Q2GCZ2 1.05e-07 56 24 12 313 3 NSE_0779 Ferredoxin--NADP reductase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q60151 1.52e-07 56 29 9 194 3 gor Glutathione reductase Streptococcus thermophilus
A4SFT9 1.98e-07 55 22 9 304 3 Cvib_1336 Ferredoxin--NADP reductase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q8CPT6 2.11e-07 55 26 7 202 3 cdr Coenzyme A disulfide reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQI9 2.11e-07 55 26 7 202 3 cdr Coenzyme A disulfide reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5GRV1 2.31e-07 55 21 11 298 3 Wbm0685 Ferredoxin--NADP reductase Wolbachia sp. subsp. Brugia malayi (strain TRS)
O89049 2.62e-07 55 24 6 202 1 Txnrd1 Thioredoxin reductase 1, cytoplasmic Rattus norvegicus
Q8EWR4 2.72e-07 55 27 7 170 3 MYPE1390 Ferredoxin--NADP reductase Malacoplasma penetrans (strain HF-2)
D0VWY5 3.47e-07 55 28 7 194 1 garB Glutathione amide reductase Marichromatium gracile
Q8U195 4.03e-07 54 23 11 347 1 sudA Sulfide dehydrogenase subunit alpha Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A8FB45 1.02e-06 53 22 11 297 3 BPUM_0777 Ferredoxin--NADP reductase 1 Bacillus pumilus (strain SAFR-032)
Q8NV36 1.1e-06 53 25 14 323 3 MW2294 Ferredoxin--NADP reductase Staphylococcus aureus (strain MW2)
Q6G6U7 1.1e-06 53 25 14 323 3 SAS2264 Ferredoxin--NADP reductase Staphylococcus aureus (strain MSSA476)
Q6GE59 1.12e-06 53 25 14 323 3 SAR2461 Ferredoxin--NADP reductase Staphylococcus aureus (strain MRSA252)
P06715 1.13e-06 53 28 10 234 1 gor Glutathione reductase Escherichia coli (strain K12)
Q9JMH6 1.17e-06 53 23 6 202 1 Txnrd1 Thioredoxin reductase 1, cytoplasmic Mus musculus
Q2YZ12 1.18e-06 53 26 15 324 3 SAB2252c Ferredoxin--NADP reductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
O64489 1.2e-06 53 36 3 92 2 YUC9 Probable indole-3-pyruvate monooxygenase YUCCA9 Arabidopsis thaliana
Q5FT88 1.58e-06 52 27 3 148 3 GOX0631 Ferredoxin--NADP reductase Gluconobacter oxydans (strain 621H)
Q46YY3 1.75e-06 52 24 13 310 3 Reut_A2287 Ferredoxin--NADP reductase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P48642 1.95e-06 52 26 8 203 2 GRC2 Glutathione reductase, cytosolic Oryza sativa subsp. japonica
A5FYH8 2.29e-06 52 29 4 148 3 Acry_1452 Ferredoxin--NADP reductase Acidiphilium cryptum (strain JF-5)
B2T4Y1 3.9e-06 51 22 13 314 3 Bphyt_2243 Ferredoxin--NADP reductase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1W6V2 4.1e-06 51 25 5 175 3 Ajs_1789 Ferredoxin--NADP reductase Acidovorax sp. (strain JS42)
P23189 4.17e-06 51 26 6 199 3 gor Glutathione reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q13Y97 4.47e-06 51 22 13 313 3 Bxeno_A2404 Ferredoxin--NADP reductase Paraburkholderia xenovorans (strain LB400)
Q1LKJ7 5.11e-06 51 22 11 304 3 Rmet_2452 Ferredoxin--NADP reductase 2 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A8Z563 5.72e-06 50 25 14 323 3 USA300HOU_2355 Ferredoxin--NADP reductase Staphylococcus aureus (strain USA300 / TCH1516)
Q99RQ5 5.72e-06 50 25 14 323 3 SAV2372 Ferredoxin--NADP reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJL4 5.72e-06 50 25 14 323 3 NWMN_2274 Ferredoxin--NADP reductase Staphylococcus aureus (strain Newman)
Q5HDI3 5.72e-06 50 25 14 323 3 SACOL2369 Ferredoxin--NADP reductase Staphylococcus aureus (strain COL)
A5IVF3 5.72e-06 50 25 14 323 3 SaurJH9_2396 Ferredoxin--NADP reductase Staphylococcus aureus (strain JH9)
Q2FVP8 5.72e-06 50 25 14 323 1 SAOUHSC_02654 Ferredoxin--NADP reductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEC4 5.72e-06 50 25 14 323 1 SAUSA300_2319 Ferredoxin--NADP reductase Staphylococcus aureus (strain USA300)
A6U499 5.72e-06 50 25 14 323 3 SaurJH1_2442 Ferredoxin--NADP reductase Staphylococcus aureus (strain JH1)
A7X5Z9 5.72e-06 50 25 14 323 3 SAHV_2356 Ferredoxin--NADP reductase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B3R5L8 6.04e-06 50 22 12 305 3 RALTA_A2094 Ferredoxin--NADP reductase 2 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
P42435 6.07e-06 51 27 13 251 2 nasD Nitrite reductase [NAD(P)H] Bacillus subtilis (strain 168)
Q9MYY8 7.02e-06 51 23 6 202 2 TXNRD1 Thioredoxin reductase 1, cytoplasmic Sus scrofa
A6V3A6 7.06e-06 50 27 9 228 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas aeruginosa (strain PA7)
P57112 7.93e-06 50 27 9 228 1 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PF5 7.93e-06 50 27 9 228 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZU5 7.93e-06 50 27 9 228 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas aeruginosa (strain LESB58)
Q9LKC0 8.22e-06 50 36 3 90 2 YUC5 Probable indole-3-pyruvate monooxygenase YUCCA5 Arabidopsis thaliana
B3EEF0 8.73e-06 50 24 10 297 3 Clim_1719 Ferredoxin--NADP reductase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q16881 9.78e-06 50 23 6 202 1 TXNRD1 Thioredoxin reductase 1, cytoplasmic Homo sapiens
Q5NVA2 1.08e-05 50 23 6 202 2 TXNRD1 Thioredoxin reductase 1, cytoplasmic Pongo abelii
B1J606 1.32e-05 50 25 14 328 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas putida (strain W619)
A1U1Y5 1.4e-05 50 24 15 336 3 sthA Soluble pyridine nucleotide transhydrogenase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1I7F0 1.65e-05 49 25 13 323 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas entomophila (strain L48)
Q0K8J6 3.33e-05 48 22 12 306 3 H16_A2592 Ferredoxin--NADP reductase 2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
M1W428 3.62e-05 48 25 14 306 2 tcpT Thioredoxin reductase tcpT Claviceps purpurea (strain 20.1)
Q873E8 4.01e-05 48 28 8 194 3 gtr-1 Glutathione reductase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q7A3W1 5.23e-05 48 26 14 296 1 SA2162 Ferredoxin--NADP reductase Staphylococcus aureus (strain N315)
Q8T137 6.07e-05 48 28 8 195 1 gsr Glutathione reductase Dictyostelium discoideum
Q884I6 6.93e-05 47 23 14 355 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B7VM91 7.59e-05 47 25 7 197 3 sthA Soluble pyridine nucleotide transhydrogenase Vibrio atlanticus (strain LGP32)
Q51973 0.000134 47 23 9 299 1 cmtAa p-cumate 2,3-dioxygenase system, ferredoxin--NAD(+) reductase component Pseudomonas putida
P0A0E7 0.000158 47 25 15 324 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MW2)
P0A0E8 0.000158 47 25 15 324 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus
Q6GAB8 0.000158 47 25 15 324 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MSSA476)
Q6GHY9 0.000158 47 25 15 324 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MRSA252)
P99084 0.000158 47 25 15 324 1 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain N315)
P0A0E6 0.000158 47 25 15 324 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGY8 0.000158 47 25 15 324 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain COL)
Q96NN9 0.000169 47 24 11 229 1 AIFM3 Apoptosis-inducing factor 3 Homo sapiens
B4F1H1 0.000266 46 29 7 194 3 sthA Soluble pyridine nucleotide transhydrogenase Proteus mirabilis (strain HI4320)
Q4ZV77 0.000414 45 22 14 355 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas syringae pv. syringae (strain B728a)
Q9SVU0 0.000469 45 34 3 88 2 YUC8 Probable indole-3-pyruvate monooxygenase YUCCA8 Arabidopsis thaliana
Q86VQ6 0.000742 44 26 7 206 1 TXNRD3 Thioredoxin reductase 3 Homo sapiens
P42770 0.000834 44 26 8 197 2 EMB2360 Glutathione reductase, chloroplastic Arabidopsis thaliana
Q48KI8 0.000835 44 22 14 355 3 sthA Soluble pyridine nucleotide transhydrogenase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q99MD6 0.000858 44 25 8 205 1 Txnrd3 Thioredoxin reductase 3 Mus musculus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03420
Feature type CDS
Gene trxB
Product thioredoxin-disulfide reductase
Location 756494 - 757453 (strand: -1)
Length 960 (nucleotides) / 319 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1218
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07992 Pyridine nucleotide-disulphide oxidoreductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0492 Posttranslational modification, protein turnover, chaperones (O) O Thioredoxin reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00384 thioredoxin reductase (NADPH) [EC:1.8.1.9] Selenocompound metabolism -

Protein Sequence

MSTIKHSKLIILGSGPAGYTAAVYAARANLEPVLITGVEKGGQLTTTTEVENWPGDPEGLTGPGLMDRMFQHAEKFNTEIISDHINKVDLKNRPFRLFGDEQEYTCDALIIATGASARYIGLPSEEAFKGRGVSACATCDGFFYRNQKVAVVGGGNTAVEEALYLANIASEVHLIHRRDSFRSEKILIDRLMDKVKNGNIILHTDRTLDEVLGDDMGVTKVRLKDTKSDKTEELEVMGVFIAIGHSPNTAIFEDQLALDNGYIKVQSGTQGNATQTSIEGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDALKSN

Flanking regions ( +/- flanking 50bp)

CTCCTACAATCGCTCAATTCGCATCAAGCCTAATCAAAGATGAGGTATCCATGAGCACCATCAAACATAGCAAACTTATTATTTTAGGTTCAGGTCCTGCCGGCTATACTGCAGCAGTTTATGCAGCACGAGCTAACCTAGAACCCGTGCTGATTACGGGTGTTGAAAAAGGAGGACAGCTCACTACCACAACTGAAGTTGAAAACTGGCCTGGCGACCCTGAAGGATTAACTGGTCCTGGTTTAATGGATCGCATGTTTCAGCACGCTGAAAAATTTAATACCGAGATTATCTCTGACCATATCAACAAAGTCGATCTGAAAAACCGACCTTTCCGCCTATTTGGTGATGAACAAGAATATACTTGTGATGCCTTGATCATTGCAACAGGGGCATCAGCACGTTATATCGGTTTACCTTCTGAAGAAGCATTTAAAGGCCGTGGTGTTTCTGCCTGTGCAACCTGTGATGGCTTTTTCTATCGTAACCAGAAAGTTGCTGTTGTCGGTGGTGGTAATACTGCCGTAGAAGAAGCACTGTATTTAGCAAATATCGCCTCAGAAGTGCACCTAATCCACCGCCGCGATTCATTCCGCTCTGAAAAAATCTTAATTGACCGTTTAATGGACAAAGTTAAGAATGGCAATATCATTTTGCATACCGATCGTACCTTAGATGAAGTGTTAGGTGATGATATGGGTGTCACTAAAGTGCGCTTAAAAGATACGAAAAGTGATAAAACCGAAGAGCTAGAGGTCATGGGCGTCTTTATTGCTATTGGTCATAGCCCTAACACGGCAATTTTTGAAGATCAATTAGCCTTAGATAACGGTTACATTAAAGTTCAATCCGGTACGCAAGGCAATGCTACCCAAACATCTATTGAAGGTGTTTTTGCCGCAGGTGATGTAATGGATCATATTTATCGTCAAGCCATTACCTCAGCTGGTACAGGTTGTATGGCTGCTTTAGATGCAGAACGTTACTTAGACGCACTAAAATCTAACTAAAATCCTCACTTCCTTTCAAGGCGCTATTTCAGTAGCGCCTTTTACCATGT