Homologs in group_1277

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07090 FBDBKF_07090 91.5 Morganella morganii S1 trxB thioredoxin-disulfide reductase
EHELCC_03880 EHELCC_03880 91.5 Morganella morganii S2 trxB thioredoxin-disulfide reductase
NLDBIP_03880 NLDBIP_03880 91.5 Morganella morganii S4 trxB thioredoxin-disulfide reductase
LHKJJB_09710 LHKJJB_09710 91.5 Morganella morganii S3 trxB thioredoxin-disulfide reductase
HKOGLL_09265 HKOGLL_09265 91.5 Morganella morganii S5 trxB thioredoxin-disulfide reductase
PMI_RS03420 PMI_RS03420 83.7 Proteus mirabilis HI4320 trxB thioredoxin-disulfide reductase

Distribution of the homologs in the orthogroup group_1277

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1277

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9P4 0.0 541 82 1 319 1 trxB Thioredoxin reductase Escherichia coli (strain K12)
P0A9P5 0.0 541 82 1 319 3 trxB Thioredoxin reductase Escherichia coli O157:H7
Q9KSS4 0.0 537 80 0 315 3 trxB Thioredoxin reductase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P43788 3.6e-179 500 76 0 315 1 trxB Thioredoxin reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q93HX6 5.21e-170 477 71 1 318 1 None Glucosaminate ammonia-lyase Pseudomonas fluorescens
P39916 1.41e-158 448 66 1 317 3 trxB Thioredoxin reductase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P81433 3.55e-145 414 57 1 319 3 trxB Thioredoxin reductase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AJ2 3.18e-131 379 59 4 313 3 trxB Thioredoxin reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57399 3.82e-131 379 56 1 318 3 trxB Thioredoxin reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q1RJD8 2.47e-121 353 54 5 313 3 trxB Thioredoxin reductase Rickettsia bellii (strain RML369-C)
Q92I02 2.77e-117 343 54 5 313 3 trxB Thioredoxin reductase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4ULP1 1.39e-114 336 53 5 312 3 trxB Thioredoxin reductase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68WT3 8.91e-112 329 51 5 313 3 trxB Thioredoxin reductase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZD97 1.57e-111 328 51 5 313 3 trxB Thioredoxin reductase Rickettsia prowazekii (strain Madrid E)
O30973 1.82e-101 303 49 5 313 3 trxB Thioredoxin reductase Mycolicibacterium smegmatis
P52215 8.14e-100 299 49 7 322 2 trxB Thioredoxin reductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q75CM8 3.82e-99 297 49 6 323 3 TRR1 Thioredoxin reductase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q05741 5.01e-99 297 49 7 321 1 trxB Thioredoxin reductase Streptomyces clavuligerus
O84101 1.64e-98 295 49 8 321 3 trxB Thioredoxin reductase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9PKT7 3.26e-98 295 49 7 318 3 trxB Thioredoxin reductase Chlamydia muridarum (strain MoPn / Nigg)
O22229 8.62e-98 301 48 6 315 1 NTRC NADPH-dependent thioredoxin reductase 3 Arabidopsis thaliana
Q70G58 1.19e-97 300 48 6 313 1 Os07g0657900 Thioredoxin reductase NTRC Oryza sativa subsp. japonica
Q9Z8M4 6.99e-96 289 50 7 316 3 trxB Thioredoxin reductase Chlamydia pneumoniae
P51978 2.25e-95 288 48 7 320 3 cys-9 Thioredoxin reductase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P9WHH1 1.15e-94 286 48 6 308 1 trxB Thioredoxin reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHH0 1.15e-94 286 48 6 308 3 trxB Thioredoxin reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6FR39 1.85e-94 285 48 8 325 3 TRR1 Thioredoxin reductase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
P29509 2.04e-94 285 47 6 323 1 TRR1 Thioredoxin reductase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q39242 3.5e-94 287 46 7 330 2 NTR2 Thioredoxin reductase 2 Arabidopsis thaliana
P38816 4.59e-94 285 47 6 327 1 TRR2 Thioredoxin reductase 2, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6HA24 1.54e-91 279 46 6 323 3 TRR1 Thioredoxin reductase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q6C7L4 2.29e-91 278 46 6 320 3 TRR1 Thioredoxin reductase Yarrowia lipolytica (strain CLIB 122 / E 150)
P46843 2.32e-91 282 48 6 309 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
Q54UU8 3.67e-90 275 46 7 327 3 trrA Thioredoxin reductase Dictyostelium discoideum
Q6BIS1 3.22e-88 270 45 6 320 3 TRR1 Thioredoxin reductase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q92375 3.33e-87 267 44 7 325 1 trr1 Thioredoxin reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q7Z7S3 3.82e-87 267 45 6 311 2 TRR1 Thioredoxin reductase Pneumocystis carinii
Q6ZFU6 2.23e-86 265 46 6 324 2 NTRB Thioredoxin reductase NTRB Oryza sativa subsp. japonica
P43496 1.15e-85 263 44 7 326 1 TRR1 Thioredoxin reductase Penicillium chrysogenum
Q8J0U0 8.31e-85 261 44 6 311 2 TRR1 Thioredoxin reductase Pneumocystis jirovecii
Q39243 1.97e-84 262 46 8 330 1 NTR1 Thioredoxin reductase 1, mitochondrial Arabidopsis thaliana
Q69PS6 4.88e-78 245 46 6 321 3 Os06g0327300 Thioredoxin reductase NTRA Oryza sativa subsp. japonica
Q8T6Z1 4.08e-74 233 43 6 310 2 TRXB Thioredoxin reductase (Fragment) Spironucleus barkhanus
P80880 4.36e-68 218 39 4 319 1 trxB Thioredoxin reductase Bacillus subtilis (strain 168)
P66011 2.95e-66 213 42 5 313 1 trxB Thioredoxin reductase Staphylococcus aureus (strain MW2)
Q6GB66 2.95e-66 213 42 5 313 3 trxB Thioredoxin reductase Staphylococcus aureus (strain MSSA476)
P99101 2.95e-66 213 42 5 313 1 trxB Thioredoxin reductase Staphylococcus aureus (strain N315)
P66010 2.95e-66 213 42 5 313 3 trxB Thioredoxin reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHQ4 2.95e-66 213 42 5 313 3 trxB Thioredoxin reductase Staphylococcus aureus (strain COL)
Q8CPY8 5.41e-66 213 43 5 310 3 trxB Thioredoxin reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQW4 5.41e-66 213 43 5 310 3 trxB Thioredoxin reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P52213 1.33e-65 211 39 5 314 3 trxB Thioredoxin reductase Peptoclostridium litorale
Q6GIM7 1.41e-65 211 42 5 313 3 trxB Thioredoxin reductase Staphylococcus aureus (strain MRSA252)
O32823 1.47e-65 211 39 5 314 3 trxB Thioredoxin reductase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q928B5 8.06e-65 209 40 5 309 3 trxB Thioredoxin reductase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P50971 1.43e-64 209 38 5 314 1 trxB Thioredoxin reductase Peptoclostridium acidaminophilum
Q9ZL18 2.59e-62 203 37 5 311 3 trxB Thioredoxin reductase Helicobacter pylori (strain J99 / ATCC 700824)
P56431 1.74e-61 201 37 5 311 1 trxB Thioredoxin reductase Helicobacter pylori (strain ATCC 700392 / 26695)
P94284 1.1e-58 194 37 6 308 3 trxB Thioredoxin reductase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P23160 8.11e-58 191 33 6 315 3 None 34.2 kDa protein in rubredoxin operon Clostridium pasteurianum
O83790 1.1e-53 181 37 3 295 3 trxB Thioredoxin reductase Treponema pallidum (strain Nichols)
P47348 3.84e-51 174 37 7 302 3 trxB Thioredoxin reductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q58931 2.02e-48 167 33 11 311 3 MJ1536 Putative thioredoxin reductase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9PR71 2.19e-46 162 35 7 313 3 trxB Thioredoxin reductase Ureaplasma parvum serovar 3 (strain ATCC 700970)
O66790 2.53e-45 159 34 8 309 3 trxB Thioredoxin reductase Aquifex aeolicus (strain VF5)
P75531 2.38e-42 151 36 6 288 3 trxB Thioredoxin reductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P26829 1.7e-39 148 30 9 309 1 ahpF NADH dehydrogenase Ferdinandcohnia aciditolerans (strain JCM 32973 / CCTCC AB 2017280 / YN-1)
P0A156 1.1e-38 146 33 7 275 3 ahpF Alkyl hydroperoxide reductase subunit F Pseudomonas putida
P0A155 1.1e-38 146 33 7 275 3 ahpF Alkyl hydroperoxide reductase subunit F Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q6GJR8 4.69e-38 144 34 9 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain MRSA252)
Q98PK9 4.84e-38 140 33 10 314 3 trxB Thioredoxin reductase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q5HIR6 1.31e-37 143 33 9 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain COL)
O05204 1.31e-37 143 33 9 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain NCTC 8325 / PS 47)
P66013 2.36e-37 142 33 9 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain MW2)
P99118 2.36e-37 142 33 9 295 1 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain N315)
P66012 2.36e-37 142 33 9 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GC92 2.57e-37 142 33 9 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus aureus (strain MSSA476)
P19480 2.97e-36 139 31 8 300 1 ahpF Alkyl hydroperoxide reductase subunit F Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P35340 5.28e-36 139 30 8 300 1 ahpF Alkyl hydroperoxide reductase subunit F Escherichia coli (strain K12)
Q5HRY2 5.6e-36 138 33 10 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CMQ1 5.72e-36 138 33 10 295 3 ahpF Alkyl hydroperoxide reductase subunit F Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
O06465 1.27e-35 138 32 7 282 3 ahpF Alkyl hydroperoxide reductase subunit F Xanthomonas campestris pv. phaseoli
Q9I6Z2 7.39e-35 135 32 6 278 3 ahpF Alkyl hydroperoxide reductase subunit F Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P42974 6.57e-34 133 31 9 296 1 ahpF NADH dehydrogenase Bacillus subtilis (strain 168)
B2GEF7 1.47e-23 102 31 13 308 3 LAF_1703 Ferredoxin--NADP reductase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q9CF34 5.93e-23 100 24 7 302 3 LL1647 Ferredoxin--NADP reductase Lactococcus lactis subsp. lactis (strain IL1403)
A0AL74 1.65e-22 99 28 11 323 3 lwe2338 Ferredoxin--NADP reductase 2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q71X35 1.66e-22 99 29 11 323 3 LMOf2365_2364 Ferredoxin--NADP reductase 2 Listeria monocytogenes serotype 4b (strain F2365)
Q5WDV1 1.76e-22 99 27 12 327 3 ABC2925 Ferredoxin--NADP reductase 2 Shouchella clausii (strain KSM-K16)
Q928P3 3.36e-22 98 28 11 323 3 lin2489 Ferredoxin--NADP reductase 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y4P5 4.49e-22 97 28 11 323 3 lmo2390 Ferredoxin--NADP reductase 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q2ITC6 4.53e-22 98 27 14 331 3 RPB_3841 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain HaA2)
Q13AK7 8.66e-22 97 27 15 331 3 RPD_1645 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain BisB5)
B3QJ15 1.03e-21 97 27 15 331 3 Rpal_4475 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain TIE-1)
Q6N2U4 1.03e-21 97 27 15 331 1 RPA3954 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q02XL9 2.91e-21 95 25 7 302 3 LACR_1811 Ferredoxin--NADP reductase Lactococcus lactis subsp. cremoris (strain SK11)
A4ISE6 4.43e-21 95 26 11 319 3 GTNG_2905 Ferredoxin--NADP reductase Geobacillus thermodenitrificans (strain NG80-2)
Q82ZZ8 4.85e-21 95 26 10 307 3 EF_2899 Ferredoxin--NADP reductase Enterococcus faecalis (strain ATCC 700802 / V583)
A2RJC6 4.94e-21 94 25 7 302 3 llmg_0776 Ferredoxin--NADP reductase Lactococcus lactis subsp. cremoris (strain MG1363)
A0LXL9 1.45e-20 94 28 11 291 3 GFO_0125 Ferredoxin--NADP reductase 1 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q72LG3 2.25e-20 93 29 11 318 3 TT_C0096 Ferredoxin--NADP reductase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B2G9D0 3.49e-20 92 28 11 307 3 LAR_1546 Ferredoxin--NADP reductase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VM22 3.49e-20 92 28 11 307 3 Lreu_1657 Ferredoxin--NADP reductase Limosilactobacillus reuteri (strain DSM 20016)
A4YER6 3.89e-20 92 27 13 322 3 Msed_0743 Ferredoxin--NADP reductase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q07RK6 4.76e-20 92 26 15 331 3 RPE_1478 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain BisA53)
Q4JCM0 7.71e-20 91 27 13 328 3 Saci_0029 Ferredoxin--NADP reductase 1 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q5SL28 1e-19 91 29 11 318 1 TTHA0465 Ferredoxin--NADP reductase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A3CM39 2.25e-19 90 27 10 303 3 SSA_0813 Ferredoxin--NADP reductase Streptococcus sanguinis (strain SK36)
Q9K7F3 4.49e-19 89 27 10 321 3 BH3408 Ferredoxin--NADP reductase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8AXQ6 1.19e-18 88 27 10 303 3 SGO_1284 Ferredoxin--NADP reductase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q5WAF1 3.95e-18 87 27 13 329 3 ABC0094 Ferredoxin--NADP reductase 1 Shouchella clausii (strain KSM-K16)
Q97WJ5 4.66e-18 86 28 12 296 3 SSO2222 Ferredoxin--NADP reductase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q96YN9 6.82e-18 86 27 12 322 3 STK_21330 Ferredoxin--NADP reductase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q8ENX4 1.33e-17 85 28 13 321 3 OB2351 Ferredoxin--NADP reductase 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A5EMW5 2.81e-17 84 26 13 330 3 BBta_5550 Ferredoxin--NADP reductase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q3STP0 3.48e-17 84 25 15 331 3 Nwi_1089 Ferredoxin--NADP reductase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q5KVP7 4.43e-17 84 25 11 319 3 GK2954 Ferredoxin--NADP reductase Geobacillus kaustophilus (strain HTA426)
Q89HV6 5.18e-17 84 25 14 331 3 bll5883 Ferredoxin--NADP reductase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B3WCB2 5.42e-17 83 26 12 314 3 LCABL_08900 Ferredoxin--NADP reductase Lacticaseibacillus casei (strain BL23)
A4YXZ8 6.23e-17 83 26 15 332 3 BRADO5079 Ferredoxin--NADP reductase Bradyrhizobium sp. (strain ORS 278)
Q03AW0 7.12e-17 83 26 12 314 3 LSEI_0826 Ferredoxin--NADP reductase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A8GW75 8.57e-17 83 25 11 300 3 A1I_03745 Ferredoxin--NADP reductase Rickettsia bellii (strain OSU 85-389)
A0LY71 1.8e-16 82 28 12 295 3 GFO_0330 Ferredoxin--NADP reductase 2 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q1QNQ1 1.89e-16 82 24 14 331 3 Nham_1321 Ferredoxin--NADP reductase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q219B6 2.19e-16 82 26 14 330 3 RPC_1458 Ferredoxin--NADP reductase Rhodopseudomonas palustris (strain BisB18)
Q1RHV1 2.37e-16 81 25 11 300 3 RBE_0982 Ferredoxin--NADP reductase Rickettsia bellii (strain RML369-C)
B3QXE1 2.93e-16 81 27 15 324 3 Ctha_0950 Ferredoxin--NADP reductase 1 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B5E6K6 4.19e-16 80 26 10 287 3 SPG_1489 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 19F (strain G54)
B4U394 4.32e-16 80 26 9 309 3 Sez_1109 Ferredoxin--NADP reductase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q67QU3 4.52e-16 80 27 13 330 3 STH965 Ferredoxin--NADP reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q6L1Y6 5.55e-16 80 26 11 291 3 PTO0431 Ferredoxin--NADP reductase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q03JS2 5.93e-16 80 24 10 314 3 STER_1382 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M3J6 5.93e-16 80 24 10 314 3 stu1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYY3 5.93e-16 80 24 10 314 3 str1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain CNRZ 1066)
Q4J6Z4 6.47e-16 80 26 14 310 3 Saci_2144 Ferredoxin--NADP reductase 2 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P80892 6.74e-16 73 85 0 41 1 trxB Thioredoxin reductase (Fragment) Aliivibrio fischeri
B1YKW2 7.78e-16 80 26 14 327 3 Exig_2313 Ferredoxin--NADP reductase 1 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q03PJ4 8.65e-16 80 27 12 312 3 LVIS_1813 Ferredoxin--NADP reductase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8DP13 8.99e-16 80 26 10 287 3 spr1421 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04JI5 8.99e-16 80 26 10 287 3 SPD_1393 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8DUN5 1.1e-15 80 25 10 306 3 SMU_869 Ferredoxin--NADP reductase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9ZD33 1.31e-15 79 26 11 300 3 RP514 Ferredoxin--NADP reductase Rickettsia prowazekii (strain Madrid E)
Q68WM0 1.94e-15 79 26 11 300 3 RT0500 Ferredoxin--NADP reductase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q2GJY7 2.12e-15 79 26 11 293 3 APH_0734 Ferredoxin--NADP reductase Anaplasma phagocytophilum (strain HZ)
B1ICY3 2.14e-15 79 26 10 287 3 SPH_1677 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain Hungary19A-6)
Q8DYW9 2.45e-15 79 25 9 305 3 SAG1353 Ferredoxin--NADP reductase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E4H8 2.45e-15 79 25 9 305 3 gbs1423 Ferredoxin--NADP reductase Streptococcus agalactiae serotype III (strain NEM316)
Q3K0F9 2.45e-15 79 25 9 305 3 SAK_1384 Ferredoxin--NADP reductase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A7Z8C1 4.22e-15 78 26 12 321 3 RBAM_029160 Ferredoxin--NADP reductase 2 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A5FJT9 5.84e-15 77 28 13 293 3 Fjoh_1507 Ferredoxin--NADP reductase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q4ULM2 9.76e-15 77 24 11 301 3 RF_0700 Ferredoxin--NADP reductase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B2IR81 1.32e-14 76 27 11 285 3 SPCG_1548 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain CGSP14)
Q97PP0 1.32e-14 76 27 11 285 3 SP_1563 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B5XKX5 1.55e-14 76 29 10 278 3 Spy49_0668 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M49 (strain NZ131)
B2U9D2 1.64e-14 76 27 12 321 3 Rpic_0981 Ferredoxin--NADP reductase Ralstonia pickettii (strain 12J)
Q8ETS1 1.7e-14 76 24 12 324 3 OB0186 Ferredoxin--NADP reductase 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A9VRK8 1.75e-14 76 26 15 296 3 BcerKBAB4_0332 Ferredoxin--NADP reductase 1 Bacillus mycoides (strain KBAB4)
A2RF47 2.21e-14 76 29 10 278 3 SpyM51151 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JMB2 2.21e-14 76 29 10 278 3 MGAS9429_Spy0712 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCC9 2.21e-14 76 29 10 278 3 MGAS2096_Spy0727 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8P1F2 2.21e-14 76 29 10 278 3 spyM18_0909 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCQ2 2.21e-14 76 29 10 278 3 M6_Spy0676 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A0LT79 2.31e-14 75 29 11 311 3 Acel_0866 Ferredoxin--NADP reductase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P0DB07 2.34e-14 75 29 10 278 3 SPs1279 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB06 2.34e-14 75 29 10 278 3 SpyM3_0575 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1JHF5 2.43e-14 75 29 10 278 3 MGAS10270_Spy0716 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q48U54 2.7e-14 75 29 10 278 3 M28_Spy0638 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A0B5 3.85e-14 75 29 10 278 3 SPy_0850 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M1
B3CTT3 3.98e-14 75 25 10 292 3 OTT_1322 Ferredoxin--NADP reductase Orientia tsutsugamushi (strain Ikeda)
A4VXW3 4.48e-14 75 25 10 287 3 SSU05_1986 Ferredoxin--NADP reductase Streptococcus suis (strain 05ZYH33)
A4W460 4.48e-14 75 25 10 287 3 SSU98_1991 Ferredoxin--NADP reductase Streptococcus suis (strain 98HAH33)
Q6HP49 5.56e-14 75 26 15 296 3 BT9727_0321 Ferredoxin--NADP reductase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81ZB7 5.56e-14 75 26 15 296 3 BA_0352 Ferredoxin--NADP reductase 1 Bacillus anthracis
A0R951 5.56e-14 75 26 15 296 3 BALH_0343 Ferredoxin--NADP reductase 1 Bacillus thuringiensis (strain Al Hakam)
B3QXR3 5.56e-14 75 26 13 312 3 Ctha_2529 Ferredoxin--NADP reductase 2 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A6H064 5.58e-14 75 27 13 299 3 FP1670 Ferredoxin--NADP reductase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
O05268 5.72e-14 74 26 12 326 1 yumC Ferredoxin--NADP reductase 2 Bacillus subtilis (strain 168)
Q1J776 6.43e-14 74 28 10 278 3 MGAS10750_Spy0748 Ferredoxin--NADP reductase Streptococcus pyogenes serotype M4 (strain MGAS10750)
A9NFF6 7.58e-14 74 25 12 316 3 ACL_0467 Ferredoxin--NADP reductase Acholeplasma laidlawii (strain PG-8A)
A8F1N2 7.65e-14 74 24 12 297 3 RMA_0647 Ferredoxin--NADP reductase Rickettsia massiliae (strain Mtu5)
Q4FMZ1 9.53e-14 74 24 13 310 3 SAR11_0627 Ferredoxin--NADP reductase Pelagibacter ubique (strain HTCC1062)
Q65GY3 1.15e-13 74 26 15 338 3 BLi02810 Ferredoxin--NADP reductase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q5FLU4 1.29e-13 73 27 12 291 3 LBA0439 Ferredoxin--NADP reductase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A8FH11 1.48e-13 73 25 12 321 3 BPUM_2873 Ferredoxin--NADP reductase 2 Bacillus pumilus (strain SAFR-032)
A5CF57 1.65e-13 73 24 11 301 3 OTBS_1841 Ferredoxin--NADP reductase Orientia tsutsugamushi (strain Boryong)
Q71Y53 1.66e-13 73 24 12 332 3 LMOf2365_1991 Ferredoxin--NADP reductase 1 Listeria monocytogenes serotype 4b (strain F2365)
Q73EA6 1.86e-13 73 25 15 296 3 BCE_0452 Ferredoxin--NADP reductase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q473F6 1.87e-13 73 25 12 321 3 Reut_A1099 Ferredoxin--NADP reductase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A8GNK2 2.15e-13 73 25 10 300 3 A1C_03465 Ferredoxin--NADP reductase Rickettsia akari (strain Hartford)
B0BXN8 2.49e-13 73 24 12 305 3 RrIowa_0762 Ferredoxin--NADP reductase Rickettsia rickettsii (strain Iowa)
B2IHR5 3.17e-13 72 26 16 331 3 Bind_2345 Ferredoxin--NADP reductase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B1HZ05 3.18e-13 72 24 12 294 3 Bsph_0789 Ferredoxin--NADP reductase 1 Lysinibacillus sphaericus (strain C3-41)
Q8Y0A5 3.54e-13 72 27 12 315 3 RSc1139 Ferredoxin--NADP reductase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A8GS72 3.66e-13 72 24 12 305 3 A1G_03605 Ferredoxin--NADP reductase Rickettsia rickettsii (strain Sheila Smith)
A8YTT2 3.84e-13 72 27 15 304 3 lhv_0465 Ferredoxin--NADP reductase Lactobacillus helveticus (strain DPC 4571)
Q92HY3 3.84e-13 72 24 12 301 3 RC0637 Ferredoxin--NADP reductase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B3R4A7 4.99e-13 72 28 14 320 3 RALTA_A1176 Ferredoxin--NADP reductase 1 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q74KS6 8.35e-13 71 26 11 302 3 LJ_0501 Ferredoxin--NADP reductase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q0RRX8 1.41e-12 70 26 13 315 3 FRAAL1022 Ferredoxin--NADP reductase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q8Y5U4 1.45e-12 70 24 12 332 3 lmo1961 Ferredoxin--NADP reductase 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q049B3 1.68e-12 70 26 12 308 3 LBUL_1466 Ferredoxin--NADP reductase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G967 1.68e-12 70 26 12 308 3 Ldb1586 Ferredoxin--NADP reductase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
O31475 2.01e-12 70 24 15 322 1 ycgT Ferredoxin--NADP reductase 1 Bacillus subtilis (strain 168)
A0AK73 2.08e-12 70 24 13 331 3 lwe1987 Ferredoxin--NADP reductase 1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q045M0 2.13e-12 70 26 14 315 3 LGAS_0447 Ferredoxin--NADP reductase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B3CMJ8 3.59e-12 69 25 10 292 3 WP1010 Ferredoxin--NADP reductase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A8M2W8 3.64e-12 69 27 12 308 3 Sare_0817 Ferredoxin--NADP reductase Salinispora arenicola (strain CNS-205)
Q1LPH7 4.01e-12 69 25 12 330 3 Rmet_1063 Ferredoxin--NADP reductase 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B1MX70 4.18e-12 69 27 12 305 3 LCK_00289 Ferredoxin--NADP reductase Leuconostoc citreum (strain KM20)
B4SFQ3 5.66e-12 69 26 14 309 3 Ppha_1024 Ferredoxin--NADP reductase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A7GKN4 5.86e-12 68 23 13 295 3 Bcer98_0331 Ferredoxin--NADP reductase 1 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2W0C9 6.36e-12 68 27 11 304 3 amb3892 Ferredoxin--NADP reductase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A1SKI3 7.92e-12 68 25 14 314 3 Noca_2816 Ferredoxin--NADP reductase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A7HW48 9.13e-12 68 24 13 297 3 Plav_2522 Ferredoxin--NADP reductase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q65FE0 9.4e-12 68 25 12 326 3 BLi03393 Ferredoxin--NADP reductase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q1WUT6 1.04e-11 68 24 12 299 3 LSL_0439 Ferredoxin--NADP reductase Ligilactobacillus salivarius (strain UCC118)
Q92A47 1.07e-11 68 24 11 320 3 lin2075 Ferredoxin--NADP reductase 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B1YEQ1 1.09e-11 68 24 13 298 3 Exig_2773 Ferredoxin--NADP reductase 2 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q0KCD1 1.11e-11 68 26 13 322 3 H16_A1199 Ferredoxin--NADP reductase 1 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5PAR7 1.21e-11 68 25 9 292 3 AM617 Ferredoxin--NADP reductase Anaplasma marginale (strain St. Maries)
Q38YJ1 1.45e-11 67 25 10 304 3 LCA_0435 Ferredoxin--NADP reductase 2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q4L8N5 1.5e-11 67 25 15 296 3 SH0681 Ferredoxin--NADP reductase Staphylococcus haemolyticus (strain JCSC1435)
Q5FT88 1.89e-11 67 26 9 294 3 GOX0631 Ferredoxin--NADP reductase Gluconobacter oxydans (strain 621H)
B3QPZ8 4.9e-11 66 26 12 309 3 Cpar_1603 Ferredoxin--NADP reductase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B1HW35 6.09e-11 66 24 12 292 3 Bsph_2322 Ferredoxin--NADP reductase 3 Lysinibacillus sphaericus (strain C3-41)
A4X398 6.22e-11 65 27 13 306 3 Strop_0871 Ferredoxin--NADP reductase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8EYV4 7.65e-11 65 23 10 299 3 A1E_02985 Ferredoxin--NADP reductase Rickettsia canadensis (strain McKiel)
Q2JFM8 7.81e-11 65 26 13 309 3 Francci3_0530 Ferredoxin--NADP reductase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q483W3 9.68e-11 65 24 12 288 3 CPS_1923 Ferredoxin--NADP reductase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q03ZE9 1.03e-10 65 23 12 321 3 LEUM_0297 Ferredoxin--NADP reductase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q816D9 1.28e-10 65 24 11 306 1 BC_4926 Ferredoxin--NADP reductase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q73GH2 1.33e-10 65 24 9 294 3 WD_0982 Ferredoxin--NADP reductase Wolbachia pipientis wMel
Q98M06 1.4e-10 65 24 14 311 3 mll0792 Ferredoxin--NADP reductase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A8FB45 1.5e-10 65 25 14 331 3 BPUM_0777 Ferredoxin--NADP reductase 1 Bacillus pumilus (strain SAFR-032)
Q3YS71 1.66e-10 64 22 8 287 3 Ecaj_0391 Ferredoxin--NADP reductase Ehrlichia canis (strain Jake)
Q632D6 1.72e-10 64 24 11 306 3 BCE33L4658 Ferredoxin--NADP reductase Bacillus cereus (strain ZK / E33L)
Q6HBX6 1.72e-10 64 24 11 306 3 BT9727_4639 Ferredoxin--NADP reductase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q72YF6 1.72e-10 64 24 11 306 3 BCE_5065 Ferredoxin--NADP reductase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81XS0 1.72e-10 64 24 11 306 3 BA_5160 Ferredoxin--NADP reductase 2 Bacillus anthracis
A0RKB9 1.72e-10 64 24 11 306 3 BALH_4465 Ferredoxin--NADP reductase 2 Bacillus thuringiensis (strain Al Hakam)
B2T4Y1 2.18e-10 64 24 14 317 3 Bphyt_2243 Ferredoxin--NADP reductase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q04HB6 2.38e-10 64 25 10 289 3 OEOE_0163 Ferredoxin--NADP reductase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A7GUD5 2.43e-10 64 25 11 304 3 Bcer98_3539 Ferredoxin--NADP reductase 2 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q88UC0 2.54e-10 63 25 11 308 3 lp_2585 Ferredoxin--NADP reductase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q03H60 2.99e-10 63 23 12 319 3 PEPE_0366 Ferredoxin--NADP reductase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q13Y97 3.06e-10 63 24 14 313 3 Bxeno_A2404 Ferredoxin--NADP reductase Paraburkholderia xenovorans (strain LB400)
P43783 3.56e-10 64 28 11 250 3 gor Glutathione reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4JS50 3.65e-10 63 25 13 317 3 Bcep1808_6193 Ferredoxin--NADP reductase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1I067 3.76e-10 63 24 12 314 3 Bsph_0993 Ferredoxin--NADP reductase 2 Lysinibacillus sphaericus (strain C3-41)
B4S9F8 4.58e-10 63 24 13 311 3 Paes_1610 Ferredoxin--NADP reductase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q0BQJ9 4.75e-10 63 27 8 287 3 GbCGDNIH1_2006 Ferredoxin--NADP reductase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A9VMZ3 5.95e-10 63 24 11 306 3 BcerKBAB4_4748 Ferredoxin--NADP reductase 2 Bacillus mycoides (strain KBAB4)
A9H9C9 7.58e-10 62 24 13 334 3 GDI0711 Ferredoxin--NADP reductase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q2GGH5 7.62e-10 62 23 11 295 3 ECH_0649 Ferredoxin--NADP reductase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q5GRV1 1.03e-09 62 22 11 324 3 Wbm0685 Ferredoxin--NADP reductase Wolbachia sp. subsp. Brugia malayi (strain TRS)
A5FYH8 1.14e-09 62 26 11 306 3 Acry_1452 Ferredoxin--NADP reductase Acidiphilium cryptum (strain JF-5)
Q3AS18 1.27e-09 62 25 14 311 3 Cag_0944 Ferredoxin--NADP reductase Chlorobium chlorochromatii (strain CaD3)
A1BHP4 1.47e-09 62 27 15 300 3 Cpha266_1905 Ferredoxin--NADP reductase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q2RNR2 2.69e-09 61 26 7 302 3 Rru_A3439 Ferredoxin--NADP reductase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A8AA47 4.26e-09 60 26 11 319 3 Igni_0617 Ferredoxin--NADP reductase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Q8KCB2 7.85e-09 59 25 12 292 1 CT1512 Ferredoxin--NADP reductase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B2JN27 8.19e-09 59 24 13 309 3 Bphy_3740 Ferredoxin--NADP reductase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5HBC7 8.5e-09 59 22 11 299 3 Erum4020 Ferredoxin--NADP reductase Ehrlichia ruminantium (strain Welgevonden)
A4SVT8 9.81e-09 59 24 11 289 3 Pnuc_0382 Ferredoxin--NADP reductase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A4F891 1.28e-08 58 29 14 315 3 SACE_0932 Ferredoxin--NADP reductase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
B3EKW5 1.76e-08 58 25 10 293 3 Cphamn1_1733 Ferredoxin--NADP reductase Chlorobium phaeobacteroides (strain BS1)
A7Z171 2.13e-08 58 23 13 321 3 RBAM_003480 Ferredoxin--NADP reductase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8EWR4 2.65e-08 58 22 13 306 3 MYPE1390 Ferredoxin--NADP reductase Malacoplasma penetrans (strain HF-2)
Q60151 3.02e-08 58 30 11 220 3 gor Glutathione reductase Streptococcus thermophilus
Q5FH31 3.09e-08 57 22 11 299 3 ERGA_CDS_04100 Ferredoxin--NADP reductase Ehrlichia ruminantium (strain Gardel)
B3R5L8 5.45e-08 57 23 12 311 3 RALTA_A2094 Ferredoxin--NADP reductase 2 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K8J6 1.36e-07 56 23 13 305 3 H16_A2592 Ferredoxin--NADP reductase 2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q3B2Q8 1.57e-07 55 23 10 311 3 Plut_1516 Ferredoxin--NADP reductase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
O52582 1.8e-07 55 29 9 198 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q1LKJ7 1.81e-07 55 23 12 305 3 Rmet_2452 Ferredoxin--NADP reductase 2 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A8Z076 2.27e-07 55 30 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain USA300 / TCH1516)
A6QFI1 2.27e-07 55 30 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Newman)
Q2FIA5 2.27e-07 55 30 11 200 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain USA300)
A1W6V2 2.4e-07 55 25 11 297 3 Ajs_1789 Ferredoxin--NADP reductase Acidovorax sp. (strain JS42)
Q5HHB4 2.51e-07 55 30 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain COL)
Q46YY3 2.61e-07 55 23 13 305 3 Reut_A2287 Ferredoxin--NADP reductase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P42435 2.66e-07 55 29 13 244 2 nasD Nitrite reductase [NAD(P)H] Bacillus subtilis (strain 168)
Q2YWW1 2.77e-07 55 29 10 203 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IRE8 2.98e-07 55 29 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain JH9)
A6U077 2.98e-07 55 29 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain JH1)
Q8NXE8 3.14e-07 55 30 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain MW2)
Q6GAV6 3.14e-07 55 30 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain MSSA476)
Q7A6H1 4.38e-07 54 29 11 200 1 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain N315)
Q99VC0 4.38e-07 54 29 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X0I7 4.38e-07 54 29 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9LKC0 6.66e-07 53 29 7 164 2 YUC5 Probable indole-3-pyruvate monooxygenase YUCCA5 Arabidopsis thaliana
Q2GCZ2 7.03e-07 53 21 12 315 3 NSE_0779 Ferredoxin--NADP reductase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q6GIB7 9.93e-07 53 29 11 200 3 cdr Coenzyme A disulfide reductase Staphylococcus aureus (strain MRSA252)
P06715 1.06e-06 53 29 9 201 1 gor Glutathione reductase Escherichia coli (strain K12)
O64489 1.66e-06 52 28 5 141 2 YUC9 Probable indole-3-pyruvate monooxygenase YUCCA9 Arabidopsis thaliana
P50736 4.18e-06 51 22 14 321 1 bdr Bacilliredoxin reductase Bdr Bacillus subtilis (strain 168)
Q51973 5.64e-06 51 26 14 301 1 cmtAa p-cumate 2,3-dioxygenase system, ferredoxin--NAD(+) reductase component Pseudomonas putida
Q9LK94 8.91e-06 50 28 13 242 1 MDAR4 Monodehydroascorbate reductase 4, peroxisomal Arabidopsis thaliana
Q8T137 1e-05 50 29 9 195 1 gsr Glutathione reductase Dictyostelium discoideum
P42770 1.01e-05 50 26 9 205 2 EMB2360 Glutathione reductase, chloroplastic Arabidopsis thaliana
O84925 1.16e-05 50 26 10 241 1 nox NADH oxidase Streptococcus pneumoniae
Q8DP70 1.7e-05 49 26 10 241 1 nox NADH oxidase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q9JMH6 1.83e-05 49 24 7 204 1 Txnrd1 Thioredoxin reductase 1, cytoplasmic Mus musculus
Q6C5H4 3.16e-05 48 29 9 199 3 GLR1 Glutathione reductase Yarrowia lipolytica (strain CLIB 122 / E 150)
Q1QX78 4.02e-05 48 23 15 336 3 sthA Soluble pyridine nucleotide transhydrogenase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1WQW2 4.86e-05 48 24 12 297 3 Veis_4316 Ferredoxin--NADP reductase Verminephrobacter eiseniae (strain EF01-2)
Q21VM4 5.37e-05 48 28 10 183 3 Rfer_2462 Ferredoxin--NADP reductase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B3EEF0 5.93e-05 47 25 10 292 3 Clim_1719 Ferredoxin--NADP reductase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q43621 6.74e-05 48 25 11 243 2 None Glutathione reductase, cytosolic Pisum sativum
Q49ZU9 7.7e-05 47 22 11 297 3 SSP0530 Ferredoxin--NADP reductase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q93379 8.36e-05 47 29 8 167 1 gsr-1 Glutathione reductase, mitochondrial Caenorhabditis elegans
Q873E8 8.62e-05 47 29 7 178 3 gtr-1 Glutathione reductase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q9SVU0 0.000127 47 23 7 207 2 YUC8 Probable indole-3-pyruvate monooxygenase YUCCA8 Arabidopsis thaliana
B1XWQ5 0.000133 47 27 8 190 3 Lcho_2791 Ferredoxin--NADP reductase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
P80461 0.000138 47 25 9 208 1 GOR Glutathione reductase, chloroplastic (Fragment) Nicotiana tabacum
A4SFT9 0.00014 46 21 11 323 3 Cvib_1336 Ferredoxin--NADP reductase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
P50970 0.000153 47 24 15 338 3 lpd Dihydrolipoyl dehydrogenase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A1VQ12 0.000211 46 28 8 185 3 Pnap_2433 Ferredoxin--NADP reductase Polaromonas naphthalenivorans (strain CJ2)
Q8U195 0.000221 46 24 12 324 1 sudA Sulfide dehydrogenase subunit alpha Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6GE59 0.000313 45 25 16 298 3 SAR2461 Ferredoxin--NADP reductase Staphylococcus aureus (strain MRSA252)
Q16881 0.000322 45 24 7 204 1 TXNRD1 Thioredoxin reductase 1, cytoplasmic Homo sapiens
Q5NVA2 0.000368 45 23 7 204 2 TXNRD1 Thioredoxin reductase 1, cytoplasmic Pongo abelii
O89049 0.000395 45 23 7 204 1 Txnrd1 Thioredoxin reductase 1, cytoplasmic Rattus norvegicus
Q38YM3 0.000447 45 27 8 187 3 LCA_0403 Ferredoxin--NADP reductase 1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8NV36 0.00055 44 25 16 298 3 MW2294 Ferredoxin--NADP reductase Staphylococcus aureus (strain MW2)
Q6G6U7 0.00055 44 25 16 298 3 SAS2264 Ferredoxin--NADP reductase Staphylococcus aureus (strain MSSA476)
Q2YZ12 0.000565 44 25 16 298 3 SAB2252c Ferredoxin--NADP reductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A9C3H6 0.00066 44 21 11 306 3 Daci_4658 Ferredoxin--NADP reductase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q12B36 0.000669 44 26 8 180 3 Bpro_2333 Ferredoxin--NADP reductase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1TRN6 0.000721 44 30 6 154 3 Aave_3058 Ferredoxin--NADP reductase Paracidovorax citrulli (strain AAC00-1)
A2TIL1 0.000741 44 28 11 231 2 GSR Glutathione reductase, mitochondrial Callithrix jacchus
Q9LFM5 0.000785 44 23 6 188 1 YUC4 Probable indole-3-pyruvate monooxygenase YUCCA4 Arabidopsis thaliana
A8Z563 0.0009 44 25 16 298 3 USA300HOU_2355 Ferredoxin--NADP reductase Staphylococcus aureus (strain USA300 / TCH1516)
Q99RQ5 0.0009 44 25 16 298 3 SAV2372 Ferredoxin--NADP reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJL4 0.0009 44 25 16 298 3 NWMN_2274 Ferredoxin--NADP reductase Staphylococcus aureus (strain Newman)
Q5HDI3 0.0009 44 25 16 298 3 SACOL2369 Ferredoxin--NADP reductase Staphylococcus aureus (strain COL)
A5IVF3 0.0009 44 25 16 298 3 SaurJH9_2396 Ferredoxin--NADP reductase Staphylococcus aureus (strain JH9)
Q2FVP8 0.0009 44 25 16 298 1 SAOUHSC_02654 Ferredoxin--NADP reductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEC4 0.0009 44 25 16 298 1 SAUSA300_2319 Ferredoxin--NADP reductase Staphylococcus aureus (strain USA300)
A6U499 0.0009 44 25 16 298 3 SaurJH1_2442 Ferredoxin--NADP reductase Staphylococcus aureus (strain JH1)
A7X5Z9 0.0009 44 25 16 298 3 SAHV_2356 Ferredoxin--NADP reductase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A0A0H2UQZ4 0.001 44 25 10 241 3 nox NADH oxidase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P48642 0.001 44 24 8 203 2 GRC2 Glutathione reductase, cytosolic Oryza sativa subsp. japonica

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01275
Feature type CDS
Gene trxB
Product thioredoxin-disulfide reductase
Location 271284 - 272243 (strand: -1)
Length 960 (nucleotides) / 319 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1277
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07992 Pyridine nucleotide-disulphide oxidoreductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0492 Posttranslational modification, protein turnover, chaperones (O) O Thioredoxin reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00384 thioredoxin reductase (NADPH) [EC:1.8.1.9] Selenocompound metabolism -

Protein Sequence

MSATRHSKLIILGSGPAGYTAAVYAARANLNPVLITGVEVGGQLTTTTEVENWPGDPEGLTGPGLMERMQAHAEKFETEIINDYINSVDFSQRPFTLRGDSVTYTCDALIIATGASARYIGLPSEEAFKGRGVSACATCDGFFYRNQKVAVVGGGNTAVEEALYLSNIASEVHLIHRRDSFRAEKILINRLMDKVKNGNIVLHTDRTLDEVLGDNSGVTGVRLRDTGTGAAEDLTVMGCFIAIGHSPNTAIFDGQLDLENGYIRVESGTHGNATQTSVAGIFAAGDVMDHIYRQAITSAGTGCMAALDAERFIDSLADK

Flanking regions ( +/- flanking 50bp)

CTCCTACAATCTTGTGCATGCTTTTTTGCCATTCTGTTAATGAGGTGTTCATGAGCGCGACCAGACACAGTAAGTTAATTATTCTGGGTTCCGGCCCTGCCGGTTATACCGCCGCCGTTTATGCGGCGCGTGCCAATTTAAACCCGGTACTTATCACCGGTGTGGAAGTCGGTGGTCAGCTGACCACCACCACTGAGGTGGAAAACTGGCCGGGTGACCCGGAAGGTTTAACCGGACCGGGTCTGATGGAGCGCATGCAGGCGCACGCAGAAAAATTTGAAACTGAAATTATCAACGATTATATCAACTCTGTTGATTTCAGTCAGCGTCCGTTTACCCTGCGGGGCGACAGCGTAACCTATACCTGTGACGCGTTAATCATCGCCACAGGCGCATCTGCCCGTTATATCGGTCTGCCGTCCGAAGAAGCCTTCAAAGGTCGTGGTGTCTCCGCCTGTGCGACCTGTGACGGTTTTTTCTATCGTAATCAAAAAGTTGCCGTTGTCGGCGGCGGAAATACCGCTGTTGAAGAAGCGCTTTATCTCTCCAATATTGCCTCAGAAGTGCATCTGATTCACCGCCGGGACAGCTTCCGCGCAGAGAAAATTCTGATCAACCGTCTGATGGATAAAGTGAAAAACGGCAATATCGTTCTTCACACTGATCGCACCCTGGACGAGGTTTTGGGTGATAATTCCGGTGTAACCGGGGTTCGTCTGCGTGATACCGGAACCGGTGCGGCAGAAGATCTGACTGTTATGGGCTGCTTTATCGCGATTGGTCACAGCCCGAATACGGCGATTTTTGATGGTCAGCTGGATCTTGAAAACGGCTATATCCGTGTTGAGTCCGGTACTCATGGCAACGCAACCCAAACCTCTGTCGCCGGTATTTTTGCCGCCGGTGATGTGATGGATCATATCTACCGTCAGGCGATTACCTCTGCGGGAACCGGTTGCATGGCAGCACTGGATGCAGAGCGGTTTATTGACAGCCTCGCTGACAAATAATCCTGTTTTTTCAAGGCGCTATATCTGTAGCGCCTTTTCGTGTACCATGA