Homologs in group_1252

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06900 FBDBKF_06900 82.9 Morganella morganii S1 hisF Imidazole glycerol phosphate synthase subunit HisF
EHELCC_04070 EHELCC_04070 82.9 Morganella morganii S2 hisF Imidazole glycerol phosphate synthase subunit HisF
NLDBIP_04070 NLDBIP_04070 82.9 Morganella morganii S4 hisF Imidazole glycerol phosphate synthase subunit HisF
LHKJJB_09900 LHKJJB_09900 82.9 Morganella morganii S3 hisF Imidazole glycerol phosphate synthase subunit HisF
HKOGLL_09075 HKOGLL_09075 82.9 Morganella morganii S5 hisF Imidazole glycerol phosphate synthase subunit HisF
F4V73_RS01085 F4V73_RS01085 82.5 Morganella psychrotolerans hisF imidazole glycerol phosphate synthase subunit HisF

Distribution of the homologs in the orthogroup group_1252

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1252

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ESZ8 0.0 526 100 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Proteus mirabilis (strain HI4320)
Q7N6I5 3.81e-161 449 83 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1RA48 3.85e-161 449 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli (strain UTI89 / UPEC)
Q8FG48 3.85e-161 449 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TG62 3.85e-161 449 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MWU3 3.98e-161 449 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O81 (strain ED1a)
B7NQG5 6.52e-161 449 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A9ML11 1.06e-160 448 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5XPE2 1.19e-160 448 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Klebsiella pneumoniae (strain 342)
B1LP16 2.11e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli (strain SMS-3-5 / SECEC)
P60664 2.11e-160 447 83 0 257 1 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli (strain K12)
B1X6W2 2.11e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli (strain K12 / DH10B)
C4ZSB4 2.11e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli (strain K12 / MC4100 / BW2952)
B5YU81 2.11e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O157:H7 (strain EC4115 / EHEC)
P60665 2.11e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O157:H7
B7UT62 2.11e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32EF4 2.96e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shigella dysenteriae serotype 1 (strain Sd197)
A7MHE1 3.03e-160 447 82 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Cronobacter sakazakii (strain ATCC BAA-894)
Q323I7 3.73e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shigella boydii serotype 4 (strain Sb227)
B7NC65 4.03e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3Z0G0 4.69e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shigella sonnei (strain Ss046)
B7L9Q2 4.69e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli (strain 55989 / EAEC)
A1ACN7 5.41e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O1:K1 / APEC
P0A1R2 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R3 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella typhi
B5BFB5 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella paratyphi A (strain AKU_12601)
A9N7S0 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PDN6 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SX46 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella newport (strain SL254)
B4T9N9 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella heidelberg (strain SL476)
B5RBR7 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZL7 5.72e-160 447 84 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella enteritidis PT4 (strain P125109)
C6DF71 5.78e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D406 5.78e-160 447 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TBC8 7.44e-160 446 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WC74 1.21e-159 446 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Enterobacter sp. (strain 638)
B1IZ49 1.36e-159 446 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1JTW3 1.6e-159 446 81 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2TYF5 1.71e-159 446 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I896 1.71e-159 446 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli (strain SE11)
B7M404 1.71e-159 446 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O8 (strain IAI1)
A8A1P9 1.81e-159 445 82 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O9:H4 (strain HS)
A7ZNJ7 1.97e-159 445 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83R03 2.35e-159 445 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shigella flexneri
Q0T3A2 2.35e-159 445 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shigella flexneri serotype 5b (strain 8401)
B7LUF6 3.65e-159 444 82 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7MDH9 3.65e-159 444 82 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Escherichia coli O45:K1 (strain S88 / ExPEC)
B5FM46 4.25e-159 444 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella dublin (strain CT_02021853)
A8AEJ9 6.96e-159 444 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q57MR8 7.44e-159 444 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella choleraesuis (strain SC-B67)
B5EX44 8.58e-159 444 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella agona (strain SL483)
C0Q1J7 9.57e-159 444 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella paratyphi C (strain RKS4594)
B4TMS0 1.03e-158 443 83 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Salmonella schwarzengrund (strain CVM19633)
P45603 1.13e-158 443 82 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Klebsiella oxytoca
A8GC74 5.72e-158 442 81 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Serratia proteamaculans (strain 568)
Q66C54 4.54e-157 439 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia pseudotuberculosis serotype I (strain IP32953)
B2JZM4 4.54e-157 439 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P62452 4.89e-157 439 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Photobacterium profundum (strain SS9)
Q1CGW5 5.47e-157 439 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFY0 5.47e-157 439 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia pestis
Q1C9R6 5.47e-157 439 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJH5 5.47e-157 439 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JPW5 8.39e-157 439 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TKK8 2.11e-156 437 80 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Yersinia pestis (strain Pestoides F)
Q5E633 3.18e-156 437 80 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FDA4 3.84e-156 437 80 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Aliivibrio fischeri (strain MJ11)
C3LLI5 4.42e-156 437 80 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Vibrio cholerae serotype O1 (strain M66-2)
Q9KSW8 4.42e-156 437 80 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F289 4.42e-156 437 80 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B6EJ93 5.82e-156 436 79 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Aliivibrio salmonicida (strain LFI1238)
A7MX10 8.45e-156 436 78 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Vibrio campbellii (strain ATCC BAA-1116)
Q8D8Q5 1.08e-155 436 78 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Vibrio vulnificus (strain CMCP6)
Q7MLS1 4.28e-155 434 78 0 257 3 hisF1 Imidazole glycerol phosphate synthase subunit hisF1 Vibrio vulnificus (strain YJ016)
Q87QK6 5.51e-155 434 78 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VGZ7 5.39e-154 431 79 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Vibrio atlanticus (strain LGP32)
Q65RC1 1.8e-153 430 80 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B3GZH3 4.93e-153 429 80 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9CLM0 1.09e-151 426 78 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pasteurella multocida (strain Pm70)
A6VQ74 6e-151 424 79 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44436 4.42e-150 422 78 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QN69 4.42e-150 422 78 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Haemophilus influenzae (strain 86-028NP)
Q2NTX6 9.95e-150 421 78 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Sodalis glossinidius (strain morsitans)
C5BG16 1.7e-149 420 78 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Edwardsiella ictaluri (strain 93-146)
A5UA15 3.04e-149 419 77 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Haemophilus influenzae (strain PittEE)
C4LFI4 1.44e-146 413 76 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B4RU62 1.24e-145 411 75 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A1SVC5 3.23e-145 409 74 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1LT72 2.45e-143 404 74 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Baumannia cicadellinicola subsp. Homalodisca coagulata
Q0HUN4 1.3e-138 392 72 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella sp. (strain MR-7)
Q8CX42 1.91e-138 392 72 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0KWB0 2.06e-138 392 72 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella sp. (strain ANA-3)
B0TQY8 2.43e-138 392 70 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella halifaxensis (strain HAW-EB4)
Q0HJ99 2.48e-138 392 72 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella sp. (strain MR-4)
Q15RU3 2.8e-138 392 73 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B1KRF9 3.09e-138 392 71 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella woodyi (strain ATCC 51908 / MS32)
A8FWD1 3.52e-138 391 71 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella sediminis (strain HAW-EB3)
A9L4C0 1.39e-137 390 71 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella baltica (strain OS195)
A6WP22 1.39e-137 390 71 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella baltica (strain OS185)
B8E999 1.39e-137 390 71 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella baltica (strain OS223)
A4Y7H2 1.65e-137 390 71 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RJ16 1.78e-137 390 71 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella sp. (strain W3-18-1)
A4SMQ4 1.88e-137 390 77 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Aeromonas salmonicida (strain A449)
A3QF21 2.17e-137 389 72 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A0KKB0 2.83e-137 389 76 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q47XB3 6.37e-137 388 73 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1S6Z6 6.97e-137 388 71 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8H5E5 1.59e-136 387 69 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3D5B1 1.74e-136 387 71 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q083K1 2.47e-136 387 71 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella frigidimarina (strain NCIMB 400)
B8CR54 4.71e-135 384 69 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella piezotolerans (strain WP3 / JCM 13877)
Q12NT0 1.21e-134 382 70 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QWQ5 6.93e-133 379 68 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P59521 2.42e-131 374 66 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9ZHE1 3.92e-131 374 66 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57206 9.38e-126 360 63 0 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q7VQW5 5.47e-125 358 63 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Blochmanniella floridana
Q3ICD4 6.2e-121 348 62 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudoalteromonas translucida (strain TAC 125)
Q494D6 7.32e-121 348 63 0 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Blochmanniella pennsylvanica (strain BPEN)
B9KEI4 6.29e-120 345 64 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A8FNR4 5.94e-117 338 63 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7H5V4 9.83e-117 337 62 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q5HSI8 3.41e-115 333 62 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Campylobacter jejuni (strain RM1221)
Q9PM72 3.41e-115 333 62 2 257 3 hisF1 Imidazole glycerol phosphate synthase subunit hisF1 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B0RSL9 6.75e-113 327 64 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xanthomonas campestris pv. campestris (strain B100)
Q8P9N9 7.29e-113 327 64 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UU45 7.29e-113 327 64 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xanthomonas campestris pv. campestris (strain 8004)
Q3BUF2 3.72e-112 326 64 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLG6 8.36e-112 325 64 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xanthomonas axonopodis pv. citri (strain 306)
Q5H0K6 5.73e-111 323 64 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3J8 5.73e-111 323 64 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2FPM4 6.83e-111 322 62 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Stenotrophomonas maltophilia (strain K279a)
B4STP2 2.68e-110 321 61 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Stenotrophomonas maltophilia (strain R551-3)
Q0AP84 2.8e-109 318 61 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Maricaulis maris (strain MCS10)
Q87C34 1.18e-108 317 63 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U3A8 1.18e-108 317 63 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xylella fastidiosa (strain M12)
B2I5X6 1.18e-108 317 63 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xylella fastidiosa (strain M23)
Q9PBD0 3.2e-107 313 62 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xylella fastidiosa (strain 9a5c)
B0TY41 1.33e-96 286 59 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B2A6X0 1.12e-81 248 51 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q5KVD0 4.26e-80 244 49 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Geobacillus kaustophilus (strain HTA426)
A8FHQ9 1.23e-79 243 49 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus pumilus (strain SAFR-032)
A5FFX6 8.82e-79 241 49 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
C5D7N8 3.09e-78 239 48 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Geobacillus sp. (strain WCH70)
Q65EG3 4.01e-78 239 49 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A6GY75 4.73e-78 239 48 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A4ISR2 6.41e-78 238 47 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Geobacillus thermodenitrificans (strain NG80-2)
B1HVQ1 7.71e-78 238 47 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Lysinibacillus sphaericus (strain C3-41)
Q11VM1 9.59e-78 238 48 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
O66567 1.97e-77 237 50 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Aquifex aeolicus (strain VF5)
O34727 3.83e-77 236 48 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus subtilis (strain 168)
Q5WDI2 6.24e-77 236 49 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Shouchella clausii (strain KSM-K16)
A6L6Z2 1.45e-76 235 49 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A7Z962 1.53e-76 235 46 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B4SFM7 2.23e-76 234 48 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q3B2Q6 3.2e-76 234 47 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A3DJF7 1.05e-75 233 49 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A4SFU1 1.06e-75 233 47 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A6LDI7 1.29e-75 233 47 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q18C74 2.11e-75 232 48 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridioides difficile (strain 630)
A3CNT0 4.87e-75 231 48 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Streptococcus sanguinis (strain SK36)
A8AY24 6.9e-75 231 47 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q9K6Z6 8.77e-75 231 50 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5LBD7 1.24e-74 230 48 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8DTR3 1.27e-74 230 48 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q3ATG0 1.8e-74 230 46 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chlorobium chlorochromatii (strain CaD3)
Q4A049 2.03e-74 229 41 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q64RT2 3.35e-74 229 48 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacteroides fragilis (strain YCH46)
Q970Z0 3.78e-74 229 45 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q8R885 4.48e-74 229 47 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9RPQ4 7.23e-74 228 49 3 261 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A0RRT8 8.08e-74 228 48 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Campylobacter fetus subsp. fetus (strain 82-40)
B3QQ00 1.1e-73 228 46 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B3EKW7 1.26e-73 228 47 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chlorobium phaeobacteroides (strain BS1)
B7GL45 1.38e-73 228 49 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A5INE6 2.29e-73 227 49 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q4J8I9 2.3e-73 227 47 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
O29439 2.54e-73 228 46 5 275 3 hisF Imidazole glycerol phosphate synthase subunit HisF Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
B2KEU8 3.8e-73 226 46 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Elusimicrobium minutum (strain Pei191)
A7GVW5 4.05e-73 226 46 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Campylobacter curvus (strain 525.92)
B2V9M8 4.18e-73 226 47 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Sulfurihydrogenibium sp. (strain YO3AOP1)
B0K629 4.56e-73 226 47 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermoanaerobacter sp. (strain X514)
Q9X0C6 6.96e-73 226 49 3 257 1 hisF Imidazole glycerol phosphate synthase subunit HisF Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1L873 8.29e-73 226 49 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermotoga sp. (strain RQ2)
B6YQ30 8.48e-73 226 47 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Azobacteroides pseudotrichonymphae genomovar. CFP2
A0LFI1 9.39e-73 226 46 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A7ZGB2 1.1e-72 225 48 5 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Campylobacter concisus (strain 13826)
B1I556 1.15e-72 225 47 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Desulforudis audaxviator (strain MP104C)
Q8A7Z6 1.24e-72 225 48 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q24QJ5 1.37e-72 225 48 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Desulfitobacterium hafniense (strain Y51)
B8FP24 1.37e-72 225 48 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B8D116 1.46e-72 225 47 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
C4L176 1.49e-72 225 46 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q8KCB0 2.39e-72 224 45 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8NUI3 4.78e-72 224 42 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain MW2)
A8Z5H3 4.78e-72 224 42 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain USA300 / TCH1516)
Q6G602 4.78e-72 224 42 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain MSSA476)
A6QKG1 4.78e-72 224 42 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain Newman)
Q5HCM4 4.78e-72 224 42 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain COL)
Q2FDI8 4.78e-72 224 42 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain USA300)
B8I5V6 7.47e-72 223 48 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A4SV20 7.98e-72 223 47 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q30NR6 8.33e-72 223 47 4 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A9KP30 8.46e-72 223 45 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B0TDM7 1.14e-71 223 47 3 262 3 hisF Imidazole glycerol phosphate synthase subunit HisF Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q97KH8 1.55e-71 222 45 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2YZ71 1.69e-71 222 41 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain bovine RF122 / ET3-1)
P64362 1.73e-71 222 41 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain N315)
P64361 1.73e-71 222 41 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IWA0 1.73e-71 222 41 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain JH9)
A6U558 1.73e-71 222 41 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain JH1)
A7X763 1.73e-71 222 41 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q5HKP2 1.82e-71 222 41 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A1BHP6 1.97e-71 222 45 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q6GDD1 2.03e-71 222 41 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus aureus (strain MRSA252)
Q8CQ92 2.61e-71 222 41 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
B9DIP1 2.87e-71 222 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Staphylococcus carnosus (strain TM300)
Q7MAS1 3.03e-71 221 46 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B4U7M4 3.5e-71 221 46 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Hydrogenobaculum sp. (strain Y04AAS1)
B2UEE5 3.96e-71 221 44 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Ralstonia pickettii (strain 12J)
P58800 4.46e-71 221 46 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B2GBR5 7.26e-71 221 47 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q3AD48 1.07e-70 220 46 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q46WL8 5.71e-70 218 44 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B3EEF2 5.93e-70 218 45 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A5G8S9 7.12e-70 218 45 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Geotalea uraniireducens (strain Rf4)
C6E7F4 7.21e-70 218 46 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Geobacter sp. (strain M21)
B4S9G0 7.22e-70 218 45 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q1LIB2 8.53e-70 218 44 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B5EDR4 1.24e-69 218 46 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q02YX1 1.24e-69 218 43 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Lactococcus lactis subsp. cremoris (strain SK11)
Q2RGW2 1.3e-69 217 46 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8XV85 1.36e-69 218 44 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6TKT6 1.37e-69 217 46 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Alkaliphilus metalliredigens (strain QYMF)
Q7UKJ9 1.59e-69 218 44 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A9B5I5 1.73e-69 218 45 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A2RKR7 2.05e-69 217 43 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Lactococcus lactis subsp. cremoris (strain MG1363)
A3CT78 2.07e-69 218 42 2 267 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
B1XSV3 8.79e-69 215 45 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Polynucleobacter necessarius subsp. necessarius (strain STIR1)
C0QPQ6 1.05e-68 215 45 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Persephonella marina (strain DSM 14350 / EX-H1)
B9L718 1.15e-68 215 45 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A5CZ73 1.27e-68 215 47 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B3R794 1.41e-68 215 44 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A1VK42 1.5e-68 215 44 3 263 3 hisF Imidazole glycerol phosphate synthase subunit HisF Polaromonas naphthalenivorans (strain CJ2)
A4YI34 1.78e-68 214 45 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
A0M283 1.99e-68 214 46 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q0K693 2.04e-68 214 44 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B8GW15 2.44e-68 214 45 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A229 2.44e-68 214 45 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A6Q117 2.6e-68 214 45 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nitratiruptor sp. (strain SB155-2)
B9M0M0 2.6e-68 214 44 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B3QSI0 2.85e-68 214 45 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A4J707 3.35e-68 214 46 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A8EQW5 3.61e-68 214 46 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Aliarcobacter butzleri (strain RM4018)
Q12FC7 4.79e-68 214 44 3 263 3 hisF Imidazole glycerol phosphate synthase subunit HisF Polaromonas sp. (strain JS666 / ATCC BAA-500)
A8AAK3 5.74e-68 213 45 2 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Q1D4M4 6.7e-68 213 43 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Myxococcus xanthus (strain DK1622)
A9BXA1 7.98e-68 213 43 3 270 3 hisF Imidazole glycerol phosphate synthase subunit HisF Delftia acidovorans (strain DSM 14801 / SPH-1)
B8GEX3 8.58e-68 213 43 2 271 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
P60715 9.19e-68 213 43 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q1IKB2 9.91e-68 213 44 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Koribacter versatilis (strain Ellin345)
A8ZVD2 1.05e-67 213 46 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
P62453 1.21e-67 212 49 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P59119 1.43e-67 212 44 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62451 1.43e-67 212 44 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q2YAV0 1.77e-67 212 43 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8ESS2 2.16e-67 212 46 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A4Y083 2.25e-67 212 44 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas mendocina (strain ymp)
Q820Q0 2.35e-67 212 42 2 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q02EM6 2.54e-67 212 44 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3N3 2.54e-67 212 44 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas aeruginosa (strain LESB58)
Q9HU44 2.54e-67 212 44 1 255 3 hisF1 Imidazole glycerol phosphate synthase subunit hisF1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q050D2 2.57e-67 212 44 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04SA6 2.57e-67 212 44 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q9S2T7 2.76e-67 211 46 3 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A2SE09 2.97e-67 211 43 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q7SIB9 2.98e-67 211 48 3 256 1 hisF Imidazole glycerol phosphate synthase subunit HisF Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A9A5X0 3.53e-67 212 42 2 268 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nitrosopumilus maritimus (strain SCM1)
A9BJZ9 3.95e-67 211 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Petrotoga mobilis (strain DSM 10674 / SJ95)
A6QCU4 4.73e-67 211 44 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Sulfurovum sp. (strain NBC37-1)
Q7VSY6 5.03e-67 211 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WDX9 5.03e-67 211 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A5FQI9 5.17e-67 211 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B9KXJ6 5.22e-67 211 46 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
B3E617 6.85e-67 211 44 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A4VRV9 8.21e-67 210 43 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Stutzerimonas stutzeri (strain A1501)
Q2SUA8 9.44e-67 210 43 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q3ZY29 1e-66 210 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Dehalococcoides mccartyi (strain CBDB1)
A6VDQ9 1.04e-66 210 44 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas aeruginosa (strain PA7)
B6YWA9 1.32e-66 210 43 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermococcus onnurineus (strain NA1)
B2SZ59 1.57e-66 210 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q3SEU8 1.59e-66 209 43 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thiobacillus denitrificans (strain ATCC 25259)
Q13TR0 1.79e-66 209 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Paraburkholderia xenovorans (strain LB400)
Q39K85 1.95e-66 209 43 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B0SRP0 1.98e-66 209 43 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S8V2 1.98e-66 209 43 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q63Q92 2.06e-66 209 43 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia pseudomallei (strain K96243)
A3NE93 2.06e-66 209 43 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia pseudomallei (strain 668)
Q3JN02 2.06e-66 209 43 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia pseudomallei (strain 1710b)
A3P027 2.06e-66 209 43 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia pseudomallei (strain 1106a)
A3M9P1 2.2e-66 209 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I0P3 2.2e-66 209 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acinetobacter baumannii (strain ACICU)
B7IBD7 2.2e-66 209 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acinetobacter baumannii (strain AB0057)
B7GVJ5 2.2e-66 209 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acinetobacter baumannii (strain AB307-0294)
Q39YP2 2.73e-66 209 43 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q7VGZ1 2.98e-66 209 44 4 269 3 hisF Imidazole glycerol phosphate synthase subunit HisF Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B8GBF3 3.78e-66 209 46 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q01ZU6 4.25e-66 208 45 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Solibacter usitatus (strain Ellin6076)
Q7W2X9 4.46e-66 209 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B8GU32 5.2e-66 208 43 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q1BS31 5.25e-66 208 42 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia orbicola (strain AU 1054)
B1JUA5 5.25e-66 208 42 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia orbicola (strain MC0-3)
Q0BIW4 5.25e-66 208 42 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A0K3V8 5.25e-66 208 42 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia cenocepacia (strain HI2424)
A9GBI6 5.41e-66 209 44 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Sorangium cellulosum (strain So ce56)
A1A1I5 5.62e-66 208 45 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
C0Z6P4 5.78e-66 208 45 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q02133 6.09e-66 208 43 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Lactococcus lactis subsp. lactis (strain IL1403)
A5UY52 6.44e-66 208 46 1 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Roseiflexus sp. (strain RS-1)
B0KI45 7.05e-66 208 42 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas putida (strain GB-1)
A1V8H5 7.12e-66 208 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia mallei (strain SAVP1)
Q62GE5 7.12e-66 208 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia mallei (strain ATCC 23344)
A2S754 7.12e-66 208 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia mallei (strain NCTC 10229)
A3MPU4 7.12e-66 208 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia mallei (strain NCTC 10247)
A6LT22 7.41e-66 208 42 2 270 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B1YRW1 7.52e-66 208 42 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia ambifaria (strain MC40-6)
B7GQS5 7.61e-66 208 45 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B4E641 7.68e-66 208 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1I3G8 8.39e-66 208 42 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas entomophila (strain L48)
B1JED1 9.26e-66 207 42 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas putida (strain W619)
Q57854 9.26e-66 208 40 3 282 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q03VY0 1.17e-65 207 43 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B0T798 1.22e-65 207 44 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Caulobacter sp. (strain K31)
Q8GDQ6 1.28e-65 207 47 3 261 3 hisF Imidazole glycerol phosphate synthase subunit HisF (Fragment) Heliobacterium mobile
Q88R41 1.31e-65 207 42 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VX76 1.31e-65 207 42 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q6F799 1.62e-65 207 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B8J216 1.82e-65 207 44 3 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B8FFL4 1.92e-65 207 45 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Desulfatibacillum aliphaticivorans
B5YE90 2.04e-65 207 44 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
A6VHY8 2.38e-65 207 42 3 275 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
B1YL09 2.41e-65 206 44 4 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q0AEU1 2.67e-65 206 41 2 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B8E2C8 2.76e-65 206 44 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B9LFN2 2.79e-65 206 45 2 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WD80 2.79e-65 206 45 2 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A0LCF3 3.01e-65 206 43 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q88UE3 3.08e-65 206 44 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A0QX87 3.2e-65 206 44 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A9BE47 3.32e-65 206 45 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Prochlorococcus marinus (strain MIT 9211)
B2UQA2 3.49e-65 206 44 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
C4XS73 3.5e-65 206 43 2 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
O33774 3.55e-65 206 44 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q845U7 3.75e-65 206 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia multivorans (strain ATCC 17616 / 249)
Q2FPV1 3.89e-65 207 41 2 269 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q2SMB2 4.46e-65 206 44 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Hahella chejuensis (strain KCTC 2396)
Q2KTT1 4.47e-65 206 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bordetella avium (strain 197N)
B2JHX9 4.97e-65 206 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1KAV4 5.02e-65 206 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Azoarcus sp. (strain BH72)
C3PHA6 5.22e-65 206 44 4 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q6A7Y8 5.98e-65 206 41 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Cutibacterium acnes (strain DSM 16379 / KPA171202)
A1W444 6.79e-65 206 42 2 263 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acidovorax sp. (strain JS42)
B9MDW3 6.79e-65 206 42 2 263 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acidovorax ebreus (strain TPSY)
A6UR05 8.2e-65 206 40 3 276 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q47QS3 8.39e-65 205 45 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermobifida fusca (strain YX)
B3PGA4 9.13e-65 205 41 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Cellvibrio japonicus (strain Ueda107)
Q8FNZ9 1.01e-64 205 43 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q0AW41 1.03e-64 205 44 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A7I616 1.16e-64 205 38 2 271 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q81G02 1.18e-64 205 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8G6F7 1.31e-64 205 44 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bifidobacterium longum (strain NCC 2705)
Q92E88 1.44e-64 204 43 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A5WHT5 1.48e-64 204 41 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Psychrobacter sp. (strain PRwf-1)
A4T9N2 1.53e-64 205 44 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycolicibacterium gilvum (strain PYR-GCK)
C0Q9D3 1.65e-64 204 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B3DRT8 1.74e-64 204 44 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bifidobacterium longum (strain DJO10A)
B7INA3 1.93e-64 204 43 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain G9842)
A4G0J7 2e-64 205 41 3 276 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
B1MBX3 2.04e-64 204 43 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q3Z7F5 2.1e-64 204 43 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q7VDF1 2.3e-64 204 46 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B1ILB0 2.34e-64 204 45 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium botulinum (strain Okra / Type B1)
A9VLH7 2.4e-64 204 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus mycoides (strain KBAB4)
A4JAW9 2.43e-64 204 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q603K3 2.81e-64 204 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
C1DAK5 2.81e-64 204 41 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Laribacter hongkongensis (strain HLHK9)
Q1H4R2 2.82e-64 204 41 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
P60666 3.03e-64 204 44 3 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QHH6 3.38e-64 204 44 3 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycobacterium avium (strain 104)
P62454 3.55e-64 204 41 3 275 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
C1DJD3 3.63e-64 204 42 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4G9I6 3.65e-64 204 41 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Herminiimonas arsenicoxydans
Q8TYW8 4.36e-64 204 45 3 272 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q5P795 4.65e-64 203 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B1ZX57 4.85e-64 203 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q4KJS4 6.05e-64 203 41 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B7JFZ5 6.23e-64 203 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain AH820)
C1EMQ7 6.72e-64 203 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain 03BB102)
A0RBM2 6.72e-64 203 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus thuringiensis (strain Al Hakam)
A9A8U1 1.12e-63 203 41 3 275 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q5FTN3 1.48e-63 202 44 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Gluconobacter oxydans (strain 621H)
A5UMZ1 1.51e-63 202 41 4 285 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
A6VTA6 1.52e-63 202 41 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Marinomonas sp. (strain MWYL1)
B7HHG5 1.57e-63 202 43 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain B4264)
Q7P0E9 1.76e-63 202 40 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A6T376 1.88e-63 202 41 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Janthinobacterium sp. (strain Marseille)
C5CQK0 1.88e-63 202 42 2 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Variovorax paradoxus (strain S110)
A5I246 1.94e-63 202 44 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU82 1.94e-63 202 44 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium botulinum (strain ATCC 19397 / Type A)
A9GZW9 2.01e-63 202 45 4 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A2C0N7 2.02e-63 202 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Prochlorococcus marinus (strain NATL1A)
A7GDQ7 2.14e-63 201 44 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q3KJI5 2.4e-63 201 41 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas fluorescens (strain Pf0-1)
C3K6V3 2.62e-63 201 41 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas fluorescens (strain SBW25)
Q316L4 2.63e-63 201 42 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B5YIB7 3.19e-63 202 41 3 280 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q3A137 3.48e-63 201 44 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C1FN42 3.61e-63 201 44 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium botulinum (strain Kyoto / Type A2)
C3KVX6 4.16e-63 201 44 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium botulinum (strain 657 / Type Ba4)
B9IV00 5.12e-63 201 44 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain Q1)
Q2J8L3 5.15e-63 201 45 3 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q21NH5 5.18e-63 201 42 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C5BMF5 6.16e-63 201 40 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Teredinibacter turnerae (strain ATCC 39867 / T7901)
A5CRW2 6.28e-63 201 42 2 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q47AM3 6.36e-63 200 40 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Dechloromonas aromatica (strain RCB)
B7HKD4 7.99e-63 200 44 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain AH187)
Q6AF73 8.97e-63 200 41 3 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Leifsonia xyli subsp. xyli (strain CTCB07)
B2UX20 8.98e-63 200 41 2 270 3 hisF Imidazole glycerol phosphate synthase subunit HisF Clostridium botulinum (strain Alaska E43 / Type E3)
Q6HLE3 1.01e-62 200 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81T58 1.01e-62 200 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus anthracis
C3L9P7 1.01e-62 200 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P506 1.01e-62 200 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus anthracis (strain A0248)
B4RJN3 1.03e-62 200 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Neisseria gonorrhoeae (strain NCCP11945)
Q5FA23 1.03e-62 200 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9M2Q5 1.12e-62 200 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Neisseria meningitidis serogroup C (strain 053442)
Q4ZLQ2 1.29e-62 199 41 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas syringae pv. syringae (strain B728a)
Q48C81 1.29e-62 199 41 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87UG4 1.33e-62 199 41 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4JW52 1.47e-62 199 41 3 260 3 hisF Imidazole glycerol phosphate synthase subunit HisF Corynebacterium jeikeium (strain K411)
A1U5H5 1.5e-62 199 41 1 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9JVH5 1.56e-62 199 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A2STB8 1.68e-62 200 41 2 270 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
A1KSN6 1.77e-62 199 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
C5A7A2 1.88e-62 199 44 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Q63DW8 2.05e-62 199 43 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain ZK / E33L)
P60714 2.07e-62 199 41 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B1VH88 2.12e-62 199 44 3 248 3 hisF Imidazole glycerol phosphate synthase subunit HisF Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q5JFU8 2.17e-62 199 44 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q3J6Q1 2.29e-62 199 42 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q4FNT7 2.29e-62 199 40 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Pelagibacter ubique (strain HTCC1062)
Q1R080 2.64e-62 199 41 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9K0H4 3.02e-62 199 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P62449 3.1e-62 199 43 3 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cereus (strain ATCC 10987 / NRS 248)
Q1IX39 3.41e-62 199 44 3 261 3 hisF Imidazole glycerol phosphate synthase subunit HisF Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q1B7H0 4.08e-62 199 44 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycobacterium sp. (strain MCS)
A1UHK2 4.08e-62 199 44 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycobacterium sp. (strain KMS)
A3Q125 4.08e-62 199 44 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycobacterium sp. (strain JLS)
Q21U91 5.06e-62 198 41 3 270 3 hisF Imidazole glycerol phosphate synthase subunit HisF Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1TL06 6.85e-62 198 41 3 272 3 hisF Imidazole glycerol phosphate synthase subunit HisF Paracidovorax citrulli (strain AAC00-1)
B8DUB2 7.33e-62 197 44 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bifidobacterium animalis subsp. lactis (strain AD011)
Q5NMD6 8.01e-62 197 43 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A2BPR2 8.9e-62 197 44 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Prochlorococcus marinus (strain AS9601)
C1FAD8 8.96e-62 197 44 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A7GMV0 9.28e-62 197 43 3 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A8G3E4 1.05e-61 197 44 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Prochlorococcus marinus (strain MIT 9215)
B5EQF2 1.19e-61 197 44 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JA19 1.19e-61 197 44 2 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B0JY78 1.37e-61 197 45 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q0SHY7 1.39e-61 197 42 4 261 3 hisF Imidazole glycerol phosphate synthase subunit HisF Rhodococcus jostii (strain RHA1)
A1WR24 1.82e-61 197 42 3 269 3 hisF Imidazole glycerol phosphate synthase subunit HisF Verminephrobacter eiseniae (strain EF01-2)
Q9X7C2 2.44e-61 196 43 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycobacterium leprae (strain TN)
B8ZRB4 2.44e-61 196 43 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Mycobacterium leprae (strain Br4923)
Q31E64 2.74e-61 196 40 1 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B1W0M6 4.29e-61 196 43 3 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A1WW05 4.41e-61 196 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Halorhodospira halophila (strain DSM 244 / SL1)
Q3MEF5 4.57e-61 196 44 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B1H0E6 5.76e-61 196 42 3 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Endomicrobium trichonymphae
Q4FPZ3 6.56e-61 196 41 5 265 3 hisF Imidazole glycerol phosphate synthase subunit HisF Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1SL56 1.05e-60 195 42 4 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q67KI0 1.07e-60 195 44 4 256 3 hisF Imidazole glycerol phosphate synthase subunit HisF Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q46GY9 1.14e-60 195 42 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Prochlorococcus marinus (strain NATL2A)
C1ATY7 1.15e-60 195 42 4 261 3 hisF Imidazole glycerol phosphate synthase subunit HisF Rhodococcus opacus (strain B4)
P26721 1.15e-60 195 41 4 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Azospirillum brasilense
Q8YT31 1.48e-60 194 43 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2NI84 1.85e-60 195 38 4 285 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
C1A0L6 1.93e-60 194 42 4 261 3 hisF Imidazole glycerol phosphate synthase subunit HisF Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q0VM72 2.17e-60 194 38 2 259 3 hisF Imidazole glycerol phosphate synthase subunit HisF Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q82A99 2.6e-60 194 44 3 255 3 hisF Imidazole glycerol phosphate synthase subunit HisF Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A1VGY9 2.81e-60 194 41 2 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Nitratidesulfovibrio vulgaris (strain DP4)
P62450 2.81e-60 194 41 2 258 1 hisF Imidazole glycerol phosphate synthase subunit HisF Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q0C643 2.92e-60 194 45 2 235 3 hisF Imidazole glycerol phosphate synthase subunit HisF Hyphomonas neptunium (strain ATCC 15444)
Q31CA5 4.09e-60 193 44 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Prochlorococcus marinus (strain MIT 9312)
Q0W358 4.26e-60 194 42 3 272 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Q8ZY16 4.64e-60 193 44 5 259 1 hisF Imidazole glycerol phosphate synthase subunit HisF Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
C5CBK1 5.14e-60 193 46 1 215 3 hisF Imidazole glycerol phosphate synthase subunit HisF Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
A7IHN9 5.34e-60 193 42 1 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A5CXY8 5.62e-60 193 43 3 258 3 hisF Imidazole glycerol phosphate synthase subunit HisF Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q1Q835 8.28e-60 192 40 5 265 3 hisF Imidazole glycerol phosphate synthase subunit HisF Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
O27398 9.47e-60 193 41 3 275 3 hisF Imidazole glycerol phosphate synthase subunit HisF Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q18JI3 1.58e-59 192 42 5 270 3 hisF Imidazole glycerol phosphate synthase subunit HisF Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
B2ICL0 1.9e-59 192 40 2 257 3 hisF Imidazole glycerol phosphate synthase subunit HisF Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03245
Feature type CDS
Gene hisF
Product imidazole glycerol phosphate synthase subunit HisF
Location 717654 - 718427 (strand: -1)
Length 774 (nucleotides) / 257 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1252
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00977 Histidine biosynthesis protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0107 Amino acid transport and metabolism (E) E Imidazole glycerol phosphate synthase subunit HisF

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02500 imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10] Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Histidine biosynthesis, PRPP => histidine

Protein Sequence

MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAERYAKEGADELVFYDITASSDGRVVDKSWVSRVAEVIDIPFCVAGGIRSVEDAGKILSFGADKISINSPALSDPTLISRLADRYGVQCVVVGIDTWFDEKTGEYLVYQFTGDEKRTQQTPWKTLDWVQEVQQRGAGEIVLNMMNQDGVRQGYDLKQLALVRQVTQVPMIASGGAGEMSHFLDAFKLANVDGALAASVFHKQIININELKQYLAENGVKVRI

Flanking regions ( +/- flanking 50bp)

GTTGGCAGAGCACTATTAGAAGGTAAATTCACATTACAAGAGGCGATATCATGTTGGCAAAACGCATAATTCCTTGTCTTGATGTTCGTGATGGACAGGTTGTTAAAGGTGTGCAATTTCGTAACCATGAAATTATTGGTGATATTGTTCCCTTAGCAGAACGCTACGCGAAAGAAGGTGCCGACGAGCTGGTCTTTTATGATATAACCGCCTCTTCTGATGGCCGAGTAGTCGATAAAAGTTGGGTATCGCGGGTAGCCGAAGTGATTGATATTCCATTTTGTGTTGCGGGTGGCATTCGCTCAGTAGAAGATGCCGGGAAAATTCTCTCTTTTGGGGCAGATAAAATCTCAATTAATTCCCCTGCACTTTCTGATCCAACACTGATTTCTCGCCTTGCCGATCGCTACGGTGTGCAGTGTGTAGTTGTGGGAATTGATACATGGTTTGATGAAAAAACTGGGGAATATCTCGTTTATCAATTTACGGGTGATGAAAAACGCACACAACAAACGCCATGGAAAACGCTCGATTGGGTACAAGAAGTACAGCAACGAGGTGCGGGGGAAATAGTGTTAAACATGATGAACCAAGATGGTGTAAGACAAGGTTATGATTTAAAACAACTCGCACTGGTACGCCAAGTCACTCAGGTTCCCATGATAGCTTCTGGCGGTGCAGGTGAAATGTCACACTTTCTGGATGCATTTAAATTAGCCAATGTTGACGGTGCCCTTGCCGCTTCCGTATTCCATAAGCAGATCATTAATATCAACGAATTGAAACAGTATCTCGCAGAAAATGGCGTTAAGGTAAGAATATAATGAATAATACAAAACTCGCCCAATTAGATTGGCAAAAAGTCGATAACCTA