Homologs in group_1549

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09690 FBDBKF_09690 86.4 Morganella morganii S1 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
EHELCC_04490 EHELCC_04490 86.4 Morganella morganii S2 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
NLDBIP_04490 NLDBIP_04490 86.4 Morganella morganii S4 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
LHKJJB_14140 LHKJJB_14140 86.4 Morganella morganii S3 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
HKOGLL_12395 HKOGLL_12395 86.4 Morganella morganii S5 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
F4V73_RS00650 F4V73_RS00650 85.6 Morganella psychrotolerans gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase

Distribution of the homologs in the orthogroup group_1549

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1549

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EST0 0.0 511 100 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Proteus mirabilis (strain HI4320)
Q7N6S0 9.58e-157 438 87 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3Z455 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella sonnei (strain Ss046)
P62710 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella flexneri
Q0T6Y5 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella flexneri serotype 5b (strain 8401)
Q324G4 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella boydii serotype 4 (strain Sb227)
B2TUY6 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LK04 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LM46 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain SMS-3-5 / SECEC)
B6I7Q9 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain SE11)
B7N9Z7 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62707 1.87e-156 437 86 0 250 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12)
B1IXY1 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P62708 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJU6 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8Z8 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O1:K1 / APEC
A7ZY11 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O9:H4 (strain HS)
B1X786 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12 / DH10B)
C4ZXS6 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6B8 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O8 (strain IAI1)
B7MPN9 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O81 (strain ED1a)
B7NNH7 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YRF2 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62709 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O157:H7
B7LAF6 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain 55989 / EAEC)
B7MGL2 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7ULM8 1.87e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
C6DCF6 2.74e-156 437 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7ZJD0 4.75e-156 436 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8Z8B2 7.36e-156 436 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella typhi
B4TQR7 7.36e-156 436 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella schwarzengrund (strain CVM19633)
C0PWW0 7.36e-156 436 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi C (strain RKS4594)
B4SZH5 7.36e-156 436 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella newport (strain SL254)
Q57RI5 7.36e-156 436 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella choleraesuis (strain SC-B67)
B5FP39 1.02e-155 435 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella dublin (strain CT_02021853)
A8GBA2 1.55e-155 435 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Serratia proteamaculans (strain 568)
Q32IH0 2e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella dysenteriae serotype 1 (strain Sd197)
Q8ZQS2 2.13e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MTL3 2.13e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TC26 2.13e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella heidelberg (strain SL476)
B5R739 2.13e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QX43 2.13e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella enteritidis PT4 (strain P125109)
B5F050 2.13e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella agona (strain SL483)
A8AJ40 2.25e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5BC52 2.63e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi A (strain AKU_12601)
Q5PG75 2.63e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A4W897 1.3e-154 432 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Enterobacter sp. (strain 638)
Q6D7E3 7.77e-154 431 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MIX7 1.09e-153 430 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cronobacter sakazakii (strain ATCC BAA-894)
B2VBS6 6.52e-153 428 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B1JSU1 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66D83 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNS2 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis (strain Pestoides F)
Q1CFN6 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3B3 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGY5 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis
B2K8R3 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C964 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKP6 8.87e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A6T6I3 1e-152 427 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZB2 1e-152 427 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Klebsiella pneumoniae (strain 342)
A1JRT1 1.87e-152 427 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NUK6 2.65e-152 427 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sodalis glossinidius (strain morsitans)
C5BEL3 2.03e-146 412 76 0 249 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Edwardsiella ictaluri (strain 93-146)
C4K389 7.82e-131 372 69 0 249 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q8R7C8 9.9e-129 367 70 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q01YD0 2.34e-123 353 66 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Solibacter usitatus (strain Ellin6076)
B3QVL0 6.36e-123 352 66 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B0KBW9 3.72e-122 350 67 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K4E2 7.1e-122 350 67 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermoanaerobacter sp. (strain X514)
Q3AU60 3.05e-121 348 65 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium chlorochromatii (strain CaD3)
B3QPN8 1.89e-119 343 64 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B3EN99 2.33e-119 343 64 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeobacteroides (strain BS1)
Q2Y9Z7 9.65e-119 342 64 0 246 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B4SEI0 5.17e-117 337 62 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q82TU0 6.58e-117 337 61 0 247 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8KFC8 7.8e-117 337 65 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B1GZZ1 8.37e-117 337 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Endomicrobium trichonymphae
A4SDM0 9.26e-116 334 63 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q54NE6 1.11e-115 334 62 0 248 1 gpmA Probable phosphoglycerate mutase Dictyostelium discoideum
A1BE55 1.97e-115 333 61 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q39V40 2.08e-115 333 64 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B3EFK8 4.19e-115 332 63 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q1LTL3 6.52e-115 332 64 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Baumannia cicadellinicola subsp. Homalodisca coagulata
C5BJ25 3.18e-114 330 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Teredinibacter turnerae (strain ATCC 39867 / T7901)
C0QV47 8.9e-114 329 62 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q3B5J2 1.32e-113 328 63 0 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B4RZM6 1.77e-113 328 64 0 246 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q5P7N4 3.11e-113 328 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B4S616 9.51e-112 324 63 0 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B2SX15 1.46e-111 323 65 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q73M14 3.07e-111 323 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q74CR0 3.78e-111 322 61 0 243 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B3DZZ7 1.69e-110 321 61 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylacidiphilum infernorum (isolate V4)
Q7MXP1 2.28e-110 320 59 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RHB7 2.28e-110 320 59 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B1JZ61 6.69e-109 317 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia orbicola (strain MC0-3)
B4EA64 6.69e-109 317 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A6L9K8 9.7e-109 316 59 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q39CN6 1.41e-108 316 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B9J102 1.51e-108 316 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain Q1)
B7HS46 1.51e-108 316 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain AH187)
B7H7P4 2.59e-108 315 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain B4264)
Q81DD2 2.61e-108 315 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A4JI45 2.9e-108 315 63 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A1VKR6 4.7e-108 315 61 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polaromonas naphthalenivorans (strain CJ2)
Q737X5 5.44e-108 314 61 0 234 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
B2JC95 6.1e-108 314 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0BBK5 8.65e-108 314 63 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B5RQ00 9.89e-108 314 62 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia recurrentis (strain A1)
B1YNA6 1.28e-107 313 63 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia ambifaria (strain MC40-6)
B5RMK4 1.29e-107 313 62 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia duttonii (strain Ly)
Q21YW0 1.35e-107 313 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q6HIL9 1.68e-107 313 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63B92 1.77e-107 313 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain ZK / E33L)
B9MEZ2 3.47e-107 312 63 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Acidovorax ebreus (strain TPSY)
Q492W5 7.2e-107 311 58 1 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Blochmanniella pennsylvanica (strain BPEN)
A1R083 1.42e-106 311 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia turicatae (strain 91E135)
A7I8A7 1.87e-106 310 60 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q660L2 1.98e-106 310 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
C5CWV9 2.62e-106 310 60 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Variovorax paradoxus (strain S110)
Q63XU7 2.78e-106 310 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain K96243)
A3N5B0 2.78e-106 310 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 668)
Q3JWH7 2.78e-106 310 62 0 245 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 1710b)
A3NR09 2.78e-106 310 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 1106a)
A1UZX9 2.78e-106 310 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain SAVP1)
Q62F43 2.78e-106 310 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain ATCC 23344)
A2S625 2.78e-106 310 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain NCTC 10229)
A3MQ23 2.78e-106 310 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain NCTC 10247)
A1K9B9 3.35e-106 310 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Azoarcus sp. (strain BH72)
B7J2L3 3.61e-106 310 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella burgdorferi (strain ZS7)
O51602 3.61e-106 310 61 0 246 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B7IX37 4.82e-106 309 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain G9842)
B7JPK2 5.94e-106 309 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain AH820)
Q6KSL4 5.94e-106 309 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis
C3LIE5 5.94e-106 309 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAW8 5.94e-106 309 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis (strain A0248)
A9VFW9 6.48e-106 309 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus mycoides (strain KBAB4)
G4VJD5 6.6e-106 309 57 0 250 1 Smp_096760 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Schistosoma mansoni
C1EUQ5 6.85e-106 309 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain 03BB102)
A0RE96 6.85e-106 309 61 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus thuringiensis (strain Al Hakam)
Q6MJP3 7.67e-106 309 58 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B2S101 8.01e-106 309 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia hermsii (strain HS1 / DAH)
B5Y7Q7 1.16e-105 308 61 0 242 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q2FTH0 1.33e-105 308 57 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
B8GFF8 2.01e-105 308 59 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q0SMJ5 2.55e-105 308 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella afzelii (strain PKo)
Q8Y2I3 2.76e-105 308 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2T1H5 2.89e-105 308 62 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2L0A6 3.67e-105 307 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella avium (strain 197N)
B2KBU4 5.49e-105 307 57 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Elusimicrobium minutum (strain Pei191)
B1Y3R5 5.92e-105 306 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q476J7 5.93e-105 306 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q5H2V7 1.36e-104 306 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P5R0 1.36e-104 306 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q64R85 1.42e-104 306 58 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacteroides fragilis (strain YCH46)
Q5LAT7 1.42e-104 306 58 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A9IFJ0 1.49e-104 306 62 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1TTW5 2.08e-104 305 61 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paracidovorax citrulli (strain AAC00-1)
Q8D2Y4 2.75e-104 305 56 1 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Wigglesworthia glossinidia brevipalpis
Q3BR53 7.19e-104 304 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0KET8 7.66e-104 304 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B0RQR7 9.04e-104 304 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain B100)
Q8P7A1 1.2e-103 303 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWV1 1.2e-103 303 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain 8004)
A1WBJ3 1.27e-103 303 61 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Acidovorax sp. (strain JS42)
B2SRM8 1.51e-103 303 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain PXO99A)
B2AGP7 1.67e-103 303 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A6LUA1 2.1e-103 302 63 0 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q8K9N1 3.2e-103 301 60 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q7W1Q6 3.59e-103 302 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8A8R2 4.51e-103 302 57 0 248 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q732Z5 6.98e-103 301 62 0 229 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
A7GPN5 7.42e-103 301 60 0 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8A765 7.7e-103 301 58 0 248 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q7VS43 7.89e-103 301 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WQN2 7.89e-103 301 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8PIM1 8.51e-103 301 59 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas axonopodis pv. citri (strain 306)
Q5ZLN1 1.18e-102 301 57 2 253 1 PGAM1 Phosphoglycerate mutase 1 Gallus gallus
A9BUZ3 2.76e-102 300 59 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q30WZ8 1.23e-101 298 60 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B5EC38 4.82e-101 296 59 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C6E639 5.26e-101 296 60 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter sp. (strain M21)
Q97FJ6 6.34e-101 296 62 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2S2B5 1.39e-100 296 57 1 249 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema pallidum subsp. pallidum (strain SS14)
P96121 1.39e-100 296 57 1 249 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema pallidum (strain Nichols)
B4SPL6 2.79e-100 295 58 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Stenotrophomonas maltophilia (strain R551-3)
B1XS92 3.04e-100 294 57 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B2FHH6 4.93e-100 294 58 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Stenotrophomonas maltophilia (strain K279a)
Q0A915 5e-100 293 60 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A9KN01 8.62e-100 294 60 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
C4XIQ5 1e-99 293 59 0 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A4T096 1.37e-98 290 57 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1WDX2 1.49e-98 290 59 1 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Verminephrobacter eiseniae (strain EF01-2)
Q89AJ4 1.5e-98 290 56 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O70250 2.95e-98 290 54 2 253 1 Pgam2 Phosphoglycerate mutase 2 Mus musculus
P15259 1.25e-97 288 55 3 256 1 PGAM2 Phosphoglycerate mutase 2 Homo sapiens
Q3JBA8 2.86e-97 287 58 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7VR80 4.21e-97 286 54 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Blochmanniella floridana
P16290 1.12e-96 286 54 2 253 1 Pgam2 Phosphoglycerate mutase 2 Rattus norvegicus
A2SDN6 1.25e-96 286 57 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B0U2F2 3.77e-96 285 54 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xylella fastidiosa (strain M12)
Q3SZ62 4.31e-96 285 56 2 253 2 PGAM1 Phosphoglycerate mutase 1 Bos taurus
P18669 6.82e-96 284 56 2 253 1 PGAM1 Phosphoglycerate mutase 1 Homo sapiens
Q9PC88 9.43e-96 283 53 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xylella fastidiosa (strain 9a5c)
Q5RFB8 2.08e-95 283 56 2 253 2 PGAM1 Phosphoglycerate mutase 1 Pongo abelii
P25113 3.08e-95 282 55 2 253 1 Pgam1 Phosphoglycerate mutase 1 Rattus norvegicus
Q9DBJ1 3.08e-95 282 55 2 253 1 Pgam1 Phosphoglycerate mutase 1 Mus musculus
Q87CZ1 3.62e-95 282 53 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I4U0 3.62e-95 282 53 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xylella fastidiosa (strain M23)
Q32KV0 5.93e-95 281 54 3 256 2 PGAM2 Phosphoglycerate mutase 2 Bos taurus
Q929G8 3.37e-94 279 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AKV8 6.94e-94 278 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8D7J7 8.47e-94 278 55 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D995 8.47e-94 278 55 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57390 1.28e-93 277 55 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8DFA5 3.42e-93 276 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4a (strain HCC23)
A1WWH7 3.5e-93 276 58 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Halorhodospira halophila (strain DSM 244 / SL1)
Q8Y571 7.28e-93 275 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XG0 1.14e-92 275 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4b (strain F2365)
C1KXG0 1.14e-92 275 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4b (strain CLIP80459)
B6IYD3 1.48e-92 275 55 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q8RFG9 3.11e-92 274 60 0 219 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A5EV29 3.52e-92 274 54 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Dichelobacter nodosus (strain VCS1703A)
Q057P1 5.32e-92 273 54 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q8N0Y7 1.63e-90 270 53 2 253 1 PGAM4 Probable phosphoglycerate mutase 4 Homo sapiens
Q8MKE8 8.59e-90 268 53 2 253 3 PGAM4 Probable phosphoglycerate mutase 4 Pan troglodytes
Q8E0G9 1.15e-89 267 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E643 1.15e-89 267 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1U2 1.15e-89 267 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A3CLS0 1.72e-89 267 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus sanguinis (strain SK36)
Q03KA9 3.66e-89 266 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q8VVB5 3.66e-89 266 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZF1 3.66e-89 266 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain CNRZ 1066)
C1CSS1 8.22e-89 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLZ5 8.22e-89 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain P1031)
B2IRR1 8.22e-89 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain CGSP14)
B8ZM52 8.22e-89 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CFM7 1.02e-88 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain JJA)
P0A3Y4 1.02e-88 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A3Y3 1.02e-88 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1I720 1.02e-88 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain Hungary19A-6)
C1C8P5 1.02e-88 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain 70585)
B5E706 1.02e-88 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 19F (strain G54)
Q04JB4 1.02e-88 265 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B8DLN4 1.33e-88 265 56 0 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q88T35 1.67e-88 264 55 0 229 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P82612 2.67e-88 265 56 0 248 1 GPM1 Phosphoglycerate mutase Candida albicans (strain SC5314 / ATCC MYA-2876)
A8AW46 3.08e-88 264 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q5FMJ3 5.93e-88 263 55 0 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B5XM69 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD07 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48SP2 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RDV4 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J5W1 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JG44 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JL20 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAX0 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65711 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB88 2.59e-87 261 54 0 229 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD06 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99Z29 2.59e-87 261 54 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M1
A4W369 2.86e-87 261 53 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus suis (strain 98HAH33)
Q74LL9 4.43e-87 261 54 0 225 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B9DUS6 5.1e-87 261 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C0MCW5 9.72e-87 260 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U1Y5 9.72e-87 260 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8R8 9.72e-87 260 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. equi (strain 4047)
Q6AAU8 2.62e-86 259 53 2 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A6VLV0 7.9e-86 257 54 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A9M1A2 8.16e-86 257 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup C (strain 053442)
Q9JTF2 8.52e-86 257 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JYF7 1.11e-85 257 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B4RIY7 1.21e-85 257 54 0 226 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria gonorrhoeae (strain NCCP11945)
Q5F7C0 1.21e-85 257 54 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2N682 2.54e-85 256 55 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Erythrobacter litoralis (strain HTCC2594)
Q6NJL2 3.79e-85 256 56 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q38Z74 6.36e-85 255 53 0 228 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Latilactobacillus sakei subsp. sakei (strain 23K)
A1KV25 9.73e-85 254 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P59161 1.09e-84 254 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B7GUR7 1.91e-84 254 54 1 222 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
P59159 1.91e-84 254 54 1 222 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum (strain NCC 2705)
B3DQI6 1.91e-84 254 54 1 222 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum (strain DJO10A)
Q6ADH3 5.49e-84 253 53 1 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Leifsonia xyli subsp. xyli (strain CTCB07)
Q65Q32 2.33e-83 251 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q4L8T0 5.84e-83 250 51 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus haemolyticus (strain JCSC1435)
A5VB15 9.14e-83 249 55 1 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q9CKU9 9.23e-83 249 51 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pasteurella multocida (strain Pm70)
P15327 2.72e-82 249 46 3 255 1 Bpgm Bisphosphoglycerate mutase Mus musculus
Q47KS8 2.88e-82 249 51 2 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermobifida fusca (strain YX)
P07738 4.17e-82 249 47 3 255 1 BPGM Bisphosphoglycerate mutase Homo sapiens
P07952 4.55e-82 249 46 2 255 2 BPGM Bisphosphoglycerate mutase Oryctolagus cuniculus
Q727C0 4.7e-82 249 50 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q4R6L7 5.01e-82 249 47 3 255 2 BPGM Bisphosphoglycerate mutase Macaca fascicularis
Q9CIM0 6.52e-82 248 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. lactis (strain IL1403)
Q031Y3 7.12e-82 248 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. cremoris (strain SK11)
A2RI67 7.12e-82 248 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. cremoris (strain MG1363)
A1VAI9 1.04e-81 248 50 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitratidesulfovibrio vulgaris (strain DP4)
P00950 2.94e-81 246 54 0 246 1 GPM1 Phosphoglycerate mutase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B0RAW4 8.28e-81 246 54 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clavibacter sepedonicus
Q0RS35 1.01e-80 245 52 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q3T014 1.08e-80 246 45 2 255 2 BPGM Bisphosphoglycerate mutase Bos taurus
B8HCQ9 1.78e-80 244 50 3 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q4JSW4 2.02e-80 244 53 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium jeikeium (strain K411)
B0BPB3 5.47e-80 243 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1G9 5.47e-80 243 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0J2 5.47e-80 243 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B4U616 1.06e-79 243 50 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hydrogenobaculum sp. (strain Y04AAS1)
Q8FSH0 1.41e-79 242 54 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B9DL85 1.48e-79 241 48 0 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus carnosus (strain TM300)
Q0ALQ9 1.94e-79 242 52 0 219 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Maricaulis maris (strain MCS10)
B1VS80 2.11e-79 242 50 3 253 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B0US27 3.42e-79 241 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Histophilus somni (strain 2336)
Q0I4D8 3.42e-79 241 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Histophilus somni (strain 129Pt)
B8F5J4 4.07e-79 240 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Glaesserella parasuis serovar 5 (strain SH0165)
P30798 4.25e-79 240 53 1 225 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q839H4 6.51e-79 240 50 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Enterococcus faecalis (strain ATCC 700802 / V583)
C1AZ61 7.72e-79 241 52 1 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodococcus opacus (strain B4)
A0QLK3 8.34e-79 240 52 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium avium (strain 104)
Q73SU2 9.51e-79 240 52 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q0SF09 9.81e-79 240 52 1 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodococcus jostii (strain RHA1)
A1SP05 1.66e-78 239 53 3 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A0JSU9 3.26e-78 239 52 3 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Arthrobacter sp. (strain FB24)
Q0C678 3.53e-78 238 51 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hyphomonas neptunium (strain ATCC 15444)
Q49ZZ2 4.59e-78 238 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2G373 5.23e-78 238 52 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A5UDW8 5.4e-78 238 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain PittEE)
Q4QME2 5.4e-78 238 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain 86-028NP)
P44865 6.09e-78 237 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C4LLD4 6.62e-78 238 52 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q82GB8 7.2e-78 238 49 2 251 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A5UHR1 1.51e-77 236 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain PittGG)
Q8NTA5 1.65e-77 237 52 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QB41 1.65e-77 237 52 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium glutamicum (strain R)
B2HQV4 1.9e-77 237 52 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium marinum (strain ATCC BAA-535 / M)
B0SY17 2e-77 236 50 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter sp. (strain K31)
A0PVZ3 2.58e-77 237 52 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium ulcerans (strain Agy99)
Q5YP50 6.54e-77 235 51 2 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nocardia farcinica (strain IFM 10152)
Q7VL28 7.57e-77 234 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P33158 4.38e-76 234 49 2 251 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P9WIC9 5.12e-76 233 51 1 223 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIC8 5.12e-76 233 51 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZL7 5.12e-76 233 51 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKG7 5.12e-76 233 51 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KFW3 5.12e-76 233 51 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5R7 5.12e-76 233 51 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B8GYN6 6.54e-76 233 51 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A634 6.54e-76 233 51 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5CTZ0 8.81e-76 233 55 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
P53531 1.31e-75 232 48 2 243 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium leprae (strain TN)
B8ZT86 1.31e-75 232 48 2 243 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium leprae (strain Br4923)
Q1GP88 2.95e-75 231 52 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
P65709 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MW2)
A8YYG4 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6Q5 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MSSA476)
P99153 2e-73 226 47 0 226 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain N315)
P65708 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJQ5 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Newman)
Q5HDD9 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain COL)
Q2YVZ6 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IVJ6 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain JH9)
Q2FVK8 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FE81 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain USA300)
A6U4E6 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain JH1)
A7X656 2e-73 226 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE17 3.38e-73 225 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MRSA252)
Q5HLI0 3.3e-72 223 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN61 6.99e-72 222 47 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q83FQ7 1.71e-71 221 50 2 214 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Tropheryma whipplei (strain Twist)
Q83HD5 1.71e-71 221 50 2 214 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Tropheryma whipplei (strain TW08/27)
B9L9H5 8.9e-68 212 48 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q88YY8 3.12e-67 210 46 2 228 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q82XS4 9.12e-66 207 42 0 226 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2YBZ1 2.3e-62 198 43 0 227 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A7HZ35 2.37e-61 194 45 1 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q74L45 3.89e-61 195 44 2 229 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q38ZH8 1.6e-60 193 40 1 233 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q89WK1 7.65e-58 186 45 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3SW71 2.55e-57 184 45 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B2IEV6 5.64e-57 183 45 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B6JCI9 8.44e-57 183 45 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A5E8K1 1.99e-56 182 44 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
P36623 2.38e-56 182 43 1 227 1 gpm1 Phosphoglycerate mutase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B9J6R3 7.19e-56 181 45 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q11SV1 9.1e-56 181 44 3 217 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A4YJP8 1.23e-55 180 44 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium sp. (strain ORS 278)
A9W5P5 1.62e-55 180 46 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum extorquens (strain PA1)
B7KNX9 1.62e-55 180 46 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q1QRT7 2.08e-55 179 44 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B5ZWT2 2.45e-55 179 45 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q4FP74 3.06e-55 180 42 2 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pelagibacter ubique (strain HTCC1062)
Q98DM0 7.17e-55 178 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B1M6A7 7.81e-55 178 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q92T25 1.36e-54 177 44 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium meliloti (strain 1021)
Q8L1Z7 1.5e-54 177 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6FZ12 1.67e-54 177 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella quintana (strain Toulouse)
B1ZA86 1.73e-54 177 45 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A6UEW3 1.99e-54 177 44 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sinorhizobium medicae (strain WSM419)
Q21CH5 3.34e-54 176 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodopseudomonas palustris (strain BisB18)
Q1MMY4 6.29e-54 176 45 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q07UT3 6.99e-54 176 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodopseudomonas palustris (strain BisA53)
B9JYQ2 1.07e-53 175 43 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A6US15 1.68e-53 175 41 5 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
B7KIT8 2.52e-53 175 38 2 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Gloeothece citriformis (strain PCC 7424)
B3PXK3 3.23e-53 174 44 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium etli (strain CIAT 652)
A9IXE7 9.15e-53 172 43 1 214 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A7IC75 9.23e-53 172 43 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A1UTM4 9.66e-53 172 44 1 214 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A6WYJ2 1.38e-52 172 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q7NJF7 1.39e-52 172 44 2 212 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
F4I8M8 1.72e-52 176 40 4 242 2 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Arabidopsis thaliana
C3MBY8 1.74e-52 172 43 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B8EML2 3.08e-52 171 44 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
P59160 8.54e-52 170 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella suis biovar 1 (strain 1330)
A9WW62 8.54e-52 170 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9MCX8 8.54e-52 170 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q576R3 8.54e-52 170 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus biovar 1 (strain 9-941)
Q2YJN6 8.54e-52 170 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus (strain 2308)
B2SC37 8.54e-52 170 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus (strain S19)
Q9LM13 1.26e-51 174 38 5 249 2 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Arabidopsis thaliana
A5VVV5 3.89e-51 168 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YDC9 5e-51 168 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMJ1 5e-51 168 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella melitensis biotype 2 (strain ATCC 23457)
B0UBD4 8.22e-50 165 44 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylobacterium sp. (strain 4-46)
Q6MEW4 2.01e-48 162 37 4 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Protochlamydia amoebophila (strain UWE25)
Q256A6 2.38e-48 162 38 3 236 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia felis (strain Fe/C-56)
Q7NK82 9.82e-48 160 36 4 259 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q15SN0 1.27e-47 160 35 4 253 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9PLK4 1.46e-47 160 37 4 243 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia muridarum (strain MoPn / Nigg)
A8IGZ9 1.06e-46 157 43 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B0BAH7 2.23e-46 157 37 4 239 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B8U8 3.54e-46 156 37 4 239 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84727 4.49e-46 156 37 4 239 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KKX2 4.49e-46 156 37 4 239 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q821N6 9.22e-46 155 37 3 236 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q11CB5 2.92e-45 153 42 1 214 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chelativorans sp. (strain BNC1)
Q9Z743 6.29e-44 150 35 3 238 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia pneumoniae
Q5L4Y3 3.62e-43 149 36 4 236 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia abortus (strain DSM 27085 / S26/3)
Q12326 1.49e-37 136 31 9 302 1 GPM3 Phosphoglycerate mutase 3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8KL44 1.68e-36 131 32 2 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q12008 1.15e-34 129 29 8 302 1 GPM2 Phosphoglycerate mutase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8TN93 3.06e-34 126 32 3 255 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PST3 1.89e-33 124 33 4 251 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9SCS3 4.09e-13 70 29 6 188 2 At3g50520 Phosphoglycerate mutase-like protein 4 Arabidopsis thaliana
Q12040 4.48e-12 67 24 8 247 1 YOR283W Broad-specificity phosphatase YOR283W Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
W5EP13 9.58e-12 67 30 8 189 1 None 2-carboxy-D-arabinitol-1-phosphatase Triticum aestivum
O07617 2.73e-10 61 36 3 107 3 phoE Uncharacterized phosphatase PhoE Bacillus subtilis (strain 168)
Q9FNJ9 1.76e-09 60 36 4 113 1 At5g22620 Probable 2-carboxy-D-arabinitol-1-phosphatase Arabidopsis thaliana
F4KI56 1.89e-09 59 29 5 190 1 IPSP Metal-independent phosphoserine phosphatase Arabidopsis thaliana
D3DFG8 1.1e-08 57 29 6 189 1 pspA Phosphoserine phosphatase 1 Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
Q6MWZ7 4.57e-08 55 26 7 236 1 gpm2 Acid phosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q91348 3.29e-07 54 26 7 204 2 None 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Gallus gallus
A1TC01 5.63e-07 52 33 2 103 1 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9NQ88 1.29e-06 51 36 3 99 1 TIGAR Fructose-2,6-bisphosphatase TIGAR Homo sapiens
Q8BZA9 2.73e-06 50 31 5 123 1 Tigar Fructose-2,6-bisphosphatase TIGAR Mus musculus
P07953 5.51e-06 50 25 7 204 1 Pfkfb1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Rattus norvegicus
P16118 9.72e-06 49 25 7 204 1 PFKFB1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Homo sapiens
A8G9J4 2.44e-05 47 25 7 194 3 gpmB Probable phosphoglycerate mutase GpmB Serratia proteamaculans (strain 568)
A7MIJ0 3.46e-05 47 24 5 193 3 gpmB Probable phosphoglycerate mutase GpmB Cronobacter sakazakii (strain ATCC BAA-894)
P70266 3.52e-05 48 25 7 204 1 Pfkfb1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Mus musculus
P52086 4.48e-05 46 37 3 89 1 cobC Adenosylcobalamin/alpha-ribazole phosphatase Escherichia coli (strain K12)
Q91309 7.56e-05 47 25 7 204 2 None 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Aquarana catesbeiana
Q8Z0T4 9.56e-05 45 25 7 192 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella typhi
B5Y264 0.00011 45 24 6 191 3 gpmB Probable phosphoglycerate mutase GpmB Klebsiella pneumoniae (strain 342)
Q57G26 0.000134 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella choleraesuis (strain SC-B67)
O94461 0.000134 45 22 5 188 3 SPAC1687.21 Probable phosphatase C1687.21 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8ZJU8 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TU55 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella schwarzengrund (strain CVM19633)
A9N7F5 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK44 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4I9 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella newport (strain SL254)
B4TH18 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella heidelberg (strain SL476)
B5R9W3 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3B7 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella enteritidis PT4 (strain P125109)
B5FTD9 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella dublin (strain CT_02021853)
B5F543 0.000173 45 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella agona (strain SL483)
A6TI09 0.000214 44 24 5 191 3 gpmB Probable phosphoglycerate mutase GpmB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P26285 0.000233 45 27 7 205 1 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Bos taurus
A1JJB8 0.000233 44 25 7 192 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N900 0.000286 44 33 3 95 3 gpmB Probable phosphoglycerate mutase GpmB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P9WIC7 0.000344 44 32 2 102 1 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIC6 0.000344 44 32 2 102 3 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B2VH13 0.000362 44 37 0 51 3 gpmB Probable phosphoglycerate mutase GpmB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C0Q8F5 0.000368 43 25 8 194 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi C (strain RKS4594)
A9MR94 0.00044 43 37 1 62 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BAL1 0.000535 43 35 1 64 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi A (strain AKU_12601)
B7LNT7 0.000605 43 25 7 195 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P32604 0.000628 44 26 10 205 1 FBP26 Fructose-2,6-bisphosphatase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A8ALW1 0.00067 43 23 7 196 3 gpmB Probable phosphoglycerate mutase GpmB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q5NVT1 0.000849 43 26 8 205 2 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Pongo abelii

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02910
Feature type CDS
Gene gpmA
Product 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
Location 636913 - 637665 (strand: -1)
Length 753 (nucleotides) / 250 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1549
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00300 Histidine phosphatase superfamily (branch 1)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0588 Carbohydrate transport and metabolism (G) G Phosphoglycerate mutase (BPG-dependent)

Kegg Ortholog Annotation(s)

Protein Sequence

MAVTKLVLVRHGESVWNKENRFTGWTDVELSDKGRNEAQEAGKLLKAEGFTFDYAYTSVLKRAIHTLWNILDEVDQQWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDDRFPGKDPRYASLTEAELPLTESLALTIDRVTPYWEEVIKPRVASGDKVIIAAHGNSLRALVKYLDNMSEEEILELNIPTAVPLVYEFDENMKPIKRYYLGNAEEIAAKAAAVANQGKAK

Flanking regions ( +/- flanking 50bp)

AGTCCTGATTTTAAACTTATATTAAGAAAGTAATTATAGGAGTCTAAACTATGGCAGTAACTAAGCTTGTGCTAGTTCGACACGGTGAAAGTGTATGGAACAAAGAAAACCGTTTTACAGGCTGGACTGACGTTGAATTGTCAGATAAAGGCCGTAATGAAGCGCAAGAAGCAGGTAAACTGCTGAAGGCTGAAGGTTTTACTTTTGACTACGCATATACTTCTGTACTAAAACGTGCAATCCACACTCTGTGGAACATTCTTGATGAAGTTGATCAACAATGGCTGCCAGTAGAGAAAAGCTGGAAACTAAACGAACGTCACTACGGTGCATTACAAGGCTTAAACAAAGCTGAAACAGCTGAAAAATACGGTGACGAGCAAGTTAAACAATGGCGTCGTGGTTTTGCGGTTACCCCACCAGAGTTAACTAAAGATGATGATCGCTTCCCAGGTAAAGATCCACGTTATGCATCTTTAACTGAAGCTGAACTGCCATTAACAGAAAGCTTAGCGTTAACTATCGACCGTGTAACACCATATTGGGAAGAAGTCATTAAACCTCGCGTTGCTTCAGGTGATAAAGTGATTATTGCCGCTCACGGTAACTCACTGCGCGCTCTGGTTAAATACCTAGACAATATGAGTGAAGAAGAAATTCTTGAACTGAATATCCCAACAGCAGTACCTTTAGTTTACGAATTTGATGAAAATATGAAACCAATCAAACGTTACTACTTAGGTAATGCAGAAGAAATCGCAGCAAAAGCCGCGGCTGTTGCTAACCAAGGTAAAGCAAAATAATTTTACTTTTACTTTGAATTAGATAAAAAAAATGCCACTTTTGAGTGGCA