Homologs in group_1549

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09690 FBDBKF_09690 100.0 Morganella morganii S1 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
NLDBIP_04490 NLDBIP_04490 100.0 Morganella morganii S4 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
LHKJJB_14140 LHKJJB_14140 100.0 Morganella morganii S3 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
HKOGLL_12395 HKOGLL_12395 100.0 Morganella morganii S5 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
F4V73_RS00650 F4V73_RS00650 96.8 Morganella psychrotolerans gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
PMI_RS02910 PMI_RS02910 86.4 Proteus mirabilis HI4320 gpmA 2,3-diphosphoglycerate-dependent phosphoglycerate mutase

Distribution of the homologs in the orthogroup group_1549

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1549

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N6S0 1.91e-159 445 88 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EST0 2.54e-155 434 86 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Proteus mirabilis (strain HI4320)
A1JRT1 5.41e-155 433 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JSU1 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66D83 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNS2 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis (strain Pestoides F)
Q1CFN6 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3B3 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGY5 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis
B2K8R3 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C964 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKP6 4.85e-154 431 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B5BC52 9.47e-154 430 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi A (strain AKU_12601)
Q5PG75 9.47e-154 430 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZQS2 5.35e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MTL3 5.35e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TC26 5.35e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella heidelberg (strain SL476)
B5R739 5.35e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QX43 5.35e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella enteritidis PT4 (strain P125109)
B5F050 5.35e-153 428 84 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella agona (strain SL483)
Q8Z8B2 1.83e-152 427 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella typhi
B4TQR7 1.83e-152 427 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella schwarzengrund (strain CVM19633)
C0PWW0 1.83e-152 427 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi C (strain RKS4594)
B4SZH5 1.83e-152 427 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella newport (strain SL254)
Q57RI5 1.83e-152 427 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella choleraesuis (strain SC-B67)
B5FP39 2.15e-152 427 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella dublin (strain CT_02021853)
Q3Z455 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella sonnei (strain Ss046)
P62710 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella flexneri
Q0T6Y5 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella flexneri serotype 5b (strain 8401)
Q324G4 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella boydii serotype 4 (strain Sb227)
B2TUY6 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LK04 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LM46 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain SMS-3-5 / SECEC)
B6I7Q9 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain SE11)
B7N9Z7 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62707 4.69e-152 426 83 0 250 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12)
B1IXY1 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P62708 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJU6 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8Z8 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O1:K1 / APEC
A7ZY11 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O9:H4 (strain HS)
B1X786 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12 / DH10B)
C4ZXS6 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6B8 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O8 (strain IAI1)
B7MPN9 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O81 (strain ED1a)
B7NNH7 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YRF2 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62709 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O157:H7
B7LAF6 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain 55989 / EAEC)
B7MGL2 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7ULM8 4.69e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B2VBS6 5.72e-152 426 83 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7ZJD0 1.12e-151 425 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q6D7E3 4.16e-151 424 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q32IH0 6.59e-151 423 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella dysenteriae serotype 1 (strain Sd197)
C6DCF6 6.96e-151 423 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MIX7 2.8e-150 421 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cronobacter sakazakii (strain ATCC BAA-894)
A4W897 2.96e-150 421 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Enterobacter sp. (strain 638)
A8GBA2 1.93e-149 419 81 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Serratia proteamaculans (strain 568)
A8AJ40 7.19e-149 418 81 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6T6I3 2.96e-148 416 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZB2 2.96e-148 416 82 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Klebsiella pneumoniae (strain 342)
C5BEL3 4.48e-146 411 77 0 249 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Edwardsiella ictaluri (strain 93-146)
Q2NUK6 1.63e-145 409 77 0 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sodalis glossinidius (strain morsitans)
C4K389 1.17e-129 369 68 0 249 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q8R7C8 9.05e-124 354 66 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B3QVL0 1.24e-123 354 65 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q54NE6 1.28e-123 354 64 0 248 1 gpmA Probable phosphoglycerate mutase Dictyostelium discoideum
B3EN99 2.57e-122 350 65 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeobacteroides (strain BS1)
Q01YD0 2.78e-122 350 64 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Solibacter usitatus (strain Ellin6076)
Q3AU60 4.85e-122 350 64 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium chlorochromatii (strain CaD3)
B3QPN8 3.43e-120 345 63 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8KFC8 3.67e-120 345 65 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B4RZM6 4.62e-120 345 66 0 246 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B4SEI0 5.11e-120 345 63 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
C5BJ25 2e-119 343 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Teredinibacter turnerae (strain ATCC 39867 / T7901)
B0KBW9 2.13e-119 343 64 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K4E2 5.23e-119 342 64 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermoanaerobacter sp. (strain X514)
B1GZZ1 8.04e-118 339 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Endomicrobium trichonymphae
Q2Y9Z7 9.41e-118 339 63 0 246 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
C0QV47 1.11e-116 337 63 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
B3EFK8 3.5e-116 335 61 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A1R083 4.13e-116 335 65 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia turicatae (strain 91E135)
A1BE55 5.54e-116 335 61 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B5RMK4 9.42e-116 334 63 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia duttonii (strain Ly)
A4SDM0 1.81e-115 333 61 0 247 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q73M14 2.08e-115 333 64 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B2S101 2.23e-115 333 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia hermsii (strain HS1 / DAH)
B5RQ00 3.91e-115 333 63 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia recurrentis (strain A1)
Q1LTL3 4.59e-115 332 63 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Baumannia cicadellinicola subsp. Homalodisca coagulata
B4S616 1.27e-114 331 63 0 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q82TU0 2.56e-114 330 60 0 247 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5P7N4 4.01e-114 330 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q3B5J2 5.93e-114 330 63 0 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B2SX15 1.05e-113 329 65 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B1YNA6 2.74e-112 325 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia ambifaria (strain MC40-6)
Q0BBK5 3.33e-112 325 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A4JI45 5.89e-112 324 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9IFJ0 6.81e-112 324 64 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B2JC95 1.86e-111 323 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1K9B9 3.92e-111 322 65 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Azoarcus sp. (strain BH72)
Q63XU7 4.09e-111 322 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain K96243)
A3N5B0 4.09e-111 322 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 668)
Q3JWH7 4.09e-111 322 64 0 245 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 1710b)
A3NR09 4.09e-111 322 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 1106a)
A1UZX9 4.09e-111 322 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain SAVP1)
Q62F43 4.09e-111 322 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain ATCC 23344)
A2S625 4.09e-111 322 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain NCTC 10229)
A3MQ23 4.09e-111 322 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain NCTC 10247)
B1JZ61 4.51e-111 322 65 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia orbicola (strain MC0-3)
B4EA64 4.51e-111 322 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q39V40 5.36e-111 322 62 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q6MJP3 9.48e-111 322 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q39CN6 1.21e-110 321 64 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B5Y7Q7 1.26e-110 321 61 0 242 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
B0RQR7 2.11e-110 320 62 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain B100)
A7I8A7 2.28e-110 320 61 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q8P7A1 2.75e-110 320 62 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWV1 2.75e-110 320 62 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain 8004)
B7J2L3 2.89e-110 320 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella burgdorferi (strain ZS7)
O51602 2.89e-110 320 60 0 246 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q2L0A6 3.24e-110 320 63 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella avium (strain 197N)
Q660L2 4.63e-110 320 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q7W1Q6 1.29e-109 318 62 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
G4VJD5 1.55e-109 318 58 0 250 1 Smp_096760 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Schistosoma mansoni
B3DZZ7 1.94e-109 318 61 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylacidiphilum infernorum (isolate V4)
Q7VS43 2.1e-109 318 62 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WQN2 2.1e-109 318 62 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2T1H5 4.94e-109 317 64 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B8GFF8 6.48e-109 317 60 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q0SMJ5 7.06e-109 317 59 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella afzelii (strain PKo)
Q0KET8 1.54e-108 316 62 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q476J7 1.55e-108 316 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3BR53 1.66e-108 316 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2AGP7 2.09e-108 315 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q5H2V7 2.33e-108 315 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P5R0 2.33e-108 315 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q21YW0 7.74e-108 314 61 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1VKR6 8.77e-108 314 60 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polaromonas naphthalenivorans (strain CJ2)
Q8Y2I3 1.18e-107 313 61 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q74CR0 1.34e-107 313 59 0 243 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8PIM1 1.36e-107 313 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas axonopodis pv. citri (strain 306)
B2SRM8 2.48e-107 313 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain PXO99A)
B1Y3R5 3.35e-107 312 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q7MXP1 4.51e-107 312 56 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RHB7 4.51e-107 312 56 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B9MEZ2 4.86e-107 312 62 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Acidovorax ebreus (strain TPSY)
C5CWV9 1.08e-106 311 60 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Variovorax paradoxus (strain S110)
B4SPL6 1.32e-106 311 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Stenotrophomonas maltophilia (strain R551-3)
Q737X5 2.79e-106 310 61 0 229 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q63B92 3.67e-106 310 61 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain ZK / E33L)
B2FHH6 4.07e-106 310 60 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Stenotrophomonas maltophilia (strain K279a)
Q6HIL9 4.23e-106 310 61 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1EUQ5 4.23e-106 310 61 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain 03BB102)
A0RE96 4.23e-106 310 61 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus thuringiensis (strain Al Hakam)
Q492W5 4.33e-106 309 58 1 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Blochmanniella pennsylvanica (strain BPEN)
B9J102 9.61e-106 308 61 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain Q1)
B7HS46 9.61e-106 308 61 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain AH187)
A6L9K8 1.14e-105 308 57 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B7H7P4 1.68e-105 308 61 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain B4264)
Q81DD2 2.6e-105 307 61 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B2KBU4 3.29e-105 307 57 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Elusimicrobium minutum (strain Pei191)
A1TTW5 3.62e-105 307 60 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paracidovorax citrulli (strain AAC00-1)
Q2FTH0 4.82e-105 307 57 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q64R85 1.01e-104 306 56 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacteroides fragilis (strain YCH46)
Q5LAT7 1.01e-104 306 56 0 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A9VFW9 1.24e-104 306 60 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus mycoides (strain KBAB4)
A1WBJ3 2.04e-104 305 61 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Acidovorax sp. (strain JS42)
Q97FJ6 1.44e-103 303 62 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B7JPK2 1.47e-103 303 60 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain AH820)
Q6KSL4 1.47e-103 303 60 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis
C3LIE5 1.47e-103 303 60 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAW8 1.47e-103 303 60 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis (strain A0248)
B7IX37 3.2e-103 302 60 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain G9842)
A9BUZ3 4.97e-103 302 59 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q8A765 2.8e-102 300 56 0 248 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B5EC38 7.27e-102 298 59 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q8D2Y4 8.85e-102 298 56 1 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Wigglesworthia glossinidia brevipalpis
C4XIQ5 2.07e-101 298 60 0 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A7GPN5 2.43e-101 297 59 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q732Z5 3.1e-101 297 60 0 229 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5ZLN1 5.89e-101 297 54 2 253 1 PGAM1 Phosphoglycerate mutase 1 Gallus gallus
A9KN01 7.36e-101 296 58 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B0U2F2 1.14e-100 296 56 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xylella fastidiosa (strain M12)
B1XS92 1.7e-100 295 56 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
C6E639 1.98e-100 295 58 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter sp. (strain M21)
Q87CZ1 2.65e-100 295 56 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I4U0 2.65e-100 295 56 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xylella fastidiosa (strain M23)
Q8K9N1 2.7e-100 294 57 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9PC88 2.7e-100 295 55 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xylella fastidiosa (strain 9a5c)
A4T096 4.82e-100 293 57 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A6LUA1 1.37e-99 293 60 0 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A2SDN6 2.48e-99 292 57 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q8A8R2 2.66e-99 292 54 0 248 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q0A915 3.24e-99 291 57 0 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q7VR80 1.5e-98 290 54 0 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Blochmanniella floridana
O70250 2.56e-98 290 53 2 253 1 Pgam2 Phosphoglycerate mutase 2 Mus musculus
P15259 2.89e-98 290 54 3 256 1 PGAM2 Phosphoglycerate mutase 2 Homo sapiens
B2S2B5 3.51e-98 290 54 1 249 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema pallidum subsp. pallidum (strain SS14)
P96121 3.51e-98 290 54 1 249 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema pallidum (strain Nichols)
A1WDX2 8.46e-98 288 58 1 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Verminephrobacter eiseniae (strain EF01-2)
A5EV29 1.05e-97 288 56 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Dichelobacter nodosus (strain VCS1703A)
Q929G8 1.1e-97 288 58 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q30WZ8 1.22e-97 288 57 0 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P16290 1.52e-97 288 53 2 253 1 Pgam2 Phosphoglycerate mutase 2 Rattus norvegicus
A0AKV8 1.91e-97 287 58 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q32KV0 3.42e-97 287 55 3 256 2 PGAM2 Phosphoglycerate mutase 2 Bos taurus
B8DFA5 1.37e-96 285 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4a (strain HCC23)
Q71XG0 2.81e-96 284 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4b (strain F2365)
C1KXG0 2.81e-96 284 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8Y571 3.53e-96 284 57 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q057P1 6.6e-96 283 55 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q3JBA8 7.28e-96 283 58 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q3SZ62 1.08e-95 283 53 2 253 2 PGAM1 Phosphoglycerate mutase 1 Bos taurus
P18669 1.45e-95 283 53 2 253 1 PGAM1 Phosphoglycerate mutase 1 Homo sapiens
Q89AJ4 2.11e-95 282 54 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q5RFB8 4.93e-95 282 53 2 253 2 PGAM1 Phosphoglycerate mutase 1 Pongo abelii
P25113 5.94e-95 281 52 2 253 1 Pgam1 Phosphoglycerate mutase 1 Rattus norvegicus
Q9DBJ1 5.94e-95 281 52 2 253 1 Pgam1 Phosphoglycerate mutase 1 Mus musculus
B8D7J7 6.1e-94 278 55 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D995 6.1e-94 278 55 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57390 1.15e-93 277 54 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B6IYD3 1.56e-92 275 55 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodospirillum centenum (strain ATCC 51521 / SW)
A1WWH7 3.75e-92 273 56 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Halorhodospira halophila (strain DSM 244 / SL1)
Q8RFG9 1.52e-91 272 58 0 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5FMJ3 1.6e-91 272 54 0 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B8DLN4 4.25e-91 271 58 0 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q74LL9 1.64e-90 270 53 0 230 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q88T35 1.7e-90 270 54 0 229 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8N0Y7 2.95e-90 270 50 2 253 1 PGAM4 Probable phosphoglycerate mutase 4 Homo sapiens
Q8MKE8 1.9e-89 268 50 2 253 3 PGAM4 Probable phosphoglycerate mutase 4 Pan troglodytes
A3CLS0 3.95e-89 266 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus sanguinis (strain SK36)
P82612 5.02e-89 266 55 0 248 1 GPM1 Phosphoglycerate mutase Candida albicans (strain SC5314 / ATCC MYA-2876)
C1CSS1 9.79e-89 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLZ5 9.79e-89 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain P1031)
B2IRR1 9.79e-89 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain CGSP14)
B8ZM52 9.79e-89 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CFM7 1.15e-88 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain JJA)
P0A3Y4 1.15e-88 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A3Y3 1.15e-88 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1I720 1.15e-88 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain Hungary19A-6)
C1C8P5 1.15e-88 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain 70585)
B5E706 1.15e-88 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 19F (strain G54)
Q04JB4 1.15e-88 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A4W369 1.37e-88 265 53 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus suis (strain 98HAH33)
A8AW46 1.53e-88 265 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q03KA9 1.82e-88 264 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q8VVB5 1.82e-88 264 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZF1 1.82e-88 264 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain CNRZ 1066)
Q8E0G9 3.08e-88 264 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E643 3.08e-88 264 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1U2 3.08e-88 264 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A6VLV0 3.66e-88 263 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q6AAU8 4.51e-88 264 54 2 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q38Z74 7.06e-88 263 53 0 228 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Latilactobacillus sakei subsp. sakei (strain 23K)
A9M1A2 7.37e-88 263 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup C (strain 053442)
B9DUS6 1.59e-87 262 53 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C0MCW5 2.46e-87 261 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U1Y5 2.46e-87 261 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8R8 2.46e-87 261 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. equi (strain 4047)
Q9JTF2 3.71e-87 261 52 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KV25 4.23e-87 261 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JYF7 5.09e-87 260 52 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q65Q32 8.15e-87 260 53 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B4RIY7 1.23e-86 259 53 2 227 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria gonorrhoeae (strain NCCP11945)
Q5F7C0 1.23e-86 259 53 2 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q6NJL2 1.37e-86 260 57 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B5XM69 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD07 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48SP2 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RDV4 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J5W1 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JG44 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JL20 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAX0 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65711 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB88 1.68e-86 259 51 0 231 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD06 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99Z29 1.68e-86 259 51 0 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M1
Q2N682 2.92e-86 258 55 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Erythrobacter litoralis (strain HTCC2594)
Q9CKU9 3.09e-86 258 52 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pasteurella multocida (strain Pm70)
Q9CIM0 4.74e-86 258 52 0 233 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. lactis (strain IL1403)
Q031Y3 7.34e-86 258 52 0 233 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. cremoris (strain SK11)
A2RI67 7.34e-86 258 52 0 233 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. cremoris (strain MG1363)
Q6ADH3 7.54e-86 258 55 1 243 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Leifsonia xyli subsp. xyli (strain CTCB07)
P59161 8.35e-86 258 52 0 229 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A5VB15 4.2e-85 256 55 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B1VS80 5.44e-85 256 52 2 251 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q0RS35 5.73e-85 256 54 2 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q4R6L7 8.88e-85 256 47 3 255 2 BPGM Bisphosphoglycerate mutase Macaca fascicularis
A0QLK3 9.17e-85 256 55 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium avium (strain 104)
Q73SU2 1.95e-84 254 55 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q727C0 1.97e-84 254 50 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P07738 2.2e-84 255 46 3 255 1 BPGM Bisphosphoglycerate mutase Homo sapiens
P00950 2.53e-84 254 54 0 246 1 GPM1 Phosphoglycerate mutase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q82GB8 3.36e-84 254 52 2 251 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B0BPB3 5.01e-84 253 51 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1G9 5.01e-84 253 51 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0J2 5.01e-84 253 51 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1VAI9 5.49e-84 254 50 0 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitratidesulfovibrio vulgaris (strain DP4)
P07952 5.67e-84 254 45 2 255 2 BPGM Bisphosphoglycerate mutase Oryctolagus cuniculus
Q0ALQ9 5.8e-84 253 53 0 224 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Maricaulis maris (strain MCS10)
B0RAW4 6.54e-84 253 55 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clavibacter sepedonicus
B8HCQ9 9.79e-84 253 51 3 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q4JSW4 2.03e-83 252 54 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium jeikeium (strain K411)
P15327 2.12e-83 252 45 3 255 1 Bpgm Bisphosphoglycerate mutase Mus musculus
Q2G373 4.12e-83 251 53 1 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B7GUR7 4.22e-83 251 52 1 222 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
P59159 4.22e-83 251 52 1 222 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum (strain NCC 2705)
B3DQI6 4.22e-83 251 52 1 222 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum (strain DJO10A)
P33158 4.87e-83 251 52 2 251 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q3T014 5.08e-83 251 45 3 255 2 BPGM Bisphosphoglycerate mutase Bos taurus
Q47KS8 6.98e-83 251 50 2 248 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermobifida fusca (strain YX)
B2HQV4 1.4e-82 250 55 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium marinum (strain ATCC BAA-535 / M)
A0PVZ3 1.8e-82 250 55 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium ulcerans (strain Agy99)
Q839H4 2.21e-82 249 50 0 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Enterococcus faecalis (strain ATCC 700802 / V583)
B8F5J4 3.42e-82 248 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Glaesserella parasuis serovar 5 (strain SH0165)
P30798 9.24e-82 247 52 1 228 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B0US27 9.65e-82 247 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Histophilus somni (strain 2336)
Q0I4D8 9.65e-82 247 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Histophilus somni (strain 129Pt)
P9WIC9 1.54e-81 247 53 1 223 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIC8 1.54e-81 247 53 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZL7 1.54e-81 247 53 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKG7 1.54e-81 247 53 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KFW3 1.54e-81 247 53 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5R7 1.54e-81 247 53 1 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0JSU9 2.36e-81 247 52 3 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Arthrobacter sp. (strain FB24)
C1AZ61 3.24e-81 246 52 1 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodococcus opacus (strain B4)
B4U616 3.5e-81 246 49 0 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hydrogenobaculum sp. (strain Y04AAS1)
Q4L8T0 3.54e-81 246 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus haemolyticus (strain JCSC1435)
P53531 5.91e-81 246 52 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium leprae (strain TN)
B8ZT86 5.91e-81 246 52 1 220 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium leprae (strain Br4923)
Q7VL28 1.72e-80 244 50 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q0SF09 1.92e-80 244 52 1 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodococcus jostii (strain RHA1)
Q1GP88 2.75e-80 243 54 1 231 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
C4LLD4 3.94e-80 244 52 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
P44865 4.12e-80 243 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDW8 5.41e-80 243 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain PittEE)
Q4QME2 5.41e-80 243 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain 86-028NP)
A5UHR1 1.59e-79 241 49 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain PittGG)
A1SP05 2e-79 242 53 3 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q5YP50 2.26e-79 242 51 2 244 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nocardia farcinica (strain IFM 10152)
A5CTZ0 3.09e-79 241 55 1 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q0C678 3.73e-79 241 51 1 228 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hyphomonas neptunium (strain ATCC 15444)
B0SY17 7.83e-79 240 51 1 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter sp. (strain K31)
Q8FSH0 7.14e-78 238 53 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B9DL85 9.85e-78 237 47 0 225 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus carnosus (strain TM300)
Q49ZZ2 1.4e-77 236 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8NTA5 2.22e-77 237 53 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QB41 2.22e-77 237 53 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium glutamicum (strain R)
B8GYN6 2.67e-76 234 51 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A634 2.67e-76 234 51 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P65709 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MW2)
A8YYG4 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6Q5 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MSSA476)
P99153 2.13e-75 231 46 0 226 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain N315)
P65708 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJQ5 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Newman)
Q5HDD9 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain COL)
Q2YVZ6 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IVJ6 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain JH9)
Q2FVK8 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FE81 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain USA300)
A6U4E6 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain JH1)
A7X656 2.13e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE17 3.08e-75 231 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MRSA252)
Q8CN61 8.66e-71 219 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLI0 1.32e-70 219 46 0 226 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9L9H5 2.19e-68 213 46 0 220 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q83FQ7 2.56e-68 213 48 2 215 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Tropheryma whipplei (strain Twist)
Q83HD5 2.56e-68 213 48 2 215 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Tropheryma whipplei (strain TW08/27)
Q88YY8 7.1e-66 207 45 1 220 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A7HZ35 5.76e-62 196 45 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2YBZ1 1.55e-59 191 42 0 227 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B1M6A7 2.32e-59 189 43 2 234 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q82XS4 2.78e-59 190 40 0 226 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q89WK1 4.02e-59 189 44 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P36623 9.34e-59 188 46 1 218 1 gpm1 Phosphoglycerate mutase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q74L45 1.07e-58 188 43 2 229 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B5ZWT2 3.44e-58 186 44 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B9J6R3 7.28e-58 186 43 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q1QRT7 1.04e-57 185 43 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SW71 1.11e-57 185 44 1 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B2IEV6 1.48e-57 185 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q4FP74 1.61e-57 186 41 2 232 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pelagibacter ubique (strain HTCC1062)
A5E8K1 1.75e-57 184 43 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q92T25 2.13e-57 184 44 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium meliloti (strain 1021)
Q1MMY4 2.25e-57 184 45 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A4YJP8 3.21e-57 184 43 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium sp. (strain ORS 278)
Q38ZH8 3.82e-57 185 40 1 225 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Latilactobacillus sakei subsp. sakei (strain 23K)
C3MBY8 4.14e-57 184 43 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6WYJ2 5.3e-57 183 45 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A6UEW3 6.25e-57 183 43 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sinorhizobium medicae (strain WSM419)
Q98DM0 6.95e-57 183 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B3PXK3 1.29e-56 182 44 1 230 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium etli (strain CIAT 652)
Q07UT3 1.5e-56 182 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodopseudomonas palustris (strain BisA53)
Q8L1Z7 3.5e-56 181 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B6JCI9 4.64e-56 181 43 1 218 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B9JYQ2 7.93e-56 181 43 1 227 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q6FZ12 1.03e-55 180 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella quintana (strain Toulouse)
Q11SV1 1.45e-55 180 43 3 217 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q21CH5 2.39e-55 179 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodopseudomonas palustris (strain BisB18)
A7IC75 2.72e-55 179 43 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A9IXE7 3.25e-55 179 44 1 214 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella tribocorum (strain CIP 105476 / IBS 506)
P59160 3.7e-55 179 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella suis biovar 1 (strain 1330)
A9WW62 3.7e-55 179 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9MCX8 3.7e-55 179 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q576R3 3.7e-55 179 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus biovar 1 (strain 9-941)
Q2YJN6 3.7e-55 179 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus (strain 2308)
B2SC37 3.7e-55 179 44 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus (strain S19)
A1UTM4 5.58e-55 178 44 1 222 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A9W5P5 1.01e-54 178 45 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum extorquens (strain PA1)
B7KNX9 1.01e-54 178 45 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A5VVV5 1.57e-54 177 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YDC9 2.03e-54 177 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMJ1 2.03e-54 177 43 1 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella melitensis biotype 2 (strain ATCC 23457)
B1ZA86 1.03e-53 175 45 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B8EML2 3.97e-53 173 43 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B0UBD4 1.11e-52 172 44 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylobacterium sp. (strain 4-46)
A6US15 1.05e-51 171 40 5 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q7NJF7 3.01e-51 169 43 2 212 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B7KIT8 3.12e-51 169 36 2 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Gloeothece citriformis (strain PCC 7424)
Q7NK82 1.44e-49 165 36 4 257 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
F4I8M8 4.27e-49 167 38 3 257 2 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Arabidopsis thaliana
A8IGZ9 4.93e-49 163 43 1 213 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9LM13 9.82e-49 166 38 4 242 2 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Arabidopsis thaliana
Q6MEW4 3.06e-48 162 35 4 246 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Protochlamydia amoebophila (strain UWE25)
Q11CB5 1.75e-47 159 42 1 214 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chelativorans sp. (strain BNC1)
Q15SN0 8.04e-47 158 35 4 253 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q256A6 6.25e-46 155 37 3 236 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia felis (strain Fe/C-56)
B0BAH7 6.84e-46 155 37 4 239 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q9PLK4 1.2e-45 155 35 4 245 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia muridarum (strain MoPn / Nigg)
O84727 1.64e-45 155 37 4 239 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KKX2 1.64e-45 155 37 4 239 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B8U8 3.03e-45 154 36 4 239 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q821N6 1.66e-44 152 36 4 250 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q5L4Y3 4.69e-41 143 35 4 237 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia abortus (strain DSM 27085 / S26/3)
Q9Z743 7.18e-41 143 34 4 240 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia pneumoniae
Q12326 7.96e-40 142 31 9 302 1 GPM3 Phosphoglycerate mutase 3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8KL44 1.17e-38 136 33 2 221 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q12008 5.68e-35 130 28 7 302 1 GPM2 Phosphoglycerate mutase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8TN93 5.85e-32 120 32 3 255 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PST3 7.48e-32 120 32 4 251 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9SCS3 3.81e-13 70 31 6 187 2 At3g50520 Phosphoglycerate mutase-like protein 4 Arabidopsis thaliana
Q12040 2.62e-12 67 24 8 243 1 YOR283W Broad-specificity phosphatase YOR283W Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
F4KI56 7.1e-12 66 30 6 195 1 IPSP Metal-independent phosphoserine phosphatase Arabidopsis thaliana
O07617 8.35e-12 65 28 5 190 3 phoE Uncharacterized phosphatase PhoE Bacillus subtilis (strain 168)
D3DFG8 1.77e-09 59 37 2 108 1 pspA Phosphoserine phosphatase 1 Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
Q9FNJ9 1.51e-08 58 36 4 113 1 At5g22620 Probable 2-carboxy-D-arabinitol-1-phosphatase Arabidopsis thaliana
Q9NQ88 1.64e-08 57 26 13 261 1 TIGAR Fructose-2,6-bisphosphatase TIGAR Homo sapiens
Q8BZA9 1.66e-08 57 27 10 212 1 Tigar Fructose-2,6-bisphosphatase TIGAR Mus musculus
A1TC01 1.85e-08 56 35 2 105 1 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
W5EP13 2.45e-08 57 36 3 105 1 None 2-carboxy-D-arabinitol-1-phosphatase Triticum aestivum
Q1JQA7 3.4e-08 56 27 8 214 2 TIGAR Fructose-2,6-bisphosphatase TIGAR Bos taurus
Q6MWZ7 1.63e-07 53 26 6 236 1 gpm2 Acid phosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q4V7R0 3.99e-07 53 26 8 218 2 tigar Fructose-2,6-bisphosphatase TIGAR Xenopus laevis
P9WIC7 7.58e-07 52 27 5 186 1 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIC6 7.58e-07 52 27 5 186 3 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B1WAX6 1.62e-06 51 27 8 217 2 tigar Fructose-2,6-bisphosphatase TIGAR Xenopus tropicalis
O94461 6.82e-06 49 23 5 187 3 SPAC1687.21 Probable phosphatase C1687.21 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P52086 1.73e-05 47 35 2 89 1 cobC Adenosylcobalamin/alpha-ribazole phosphatase Escherichia coli (strain K12)
P07953 2.07e-05 48 25 7 204 1 Pfkfb1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Rattus norvegicus
P49872 2.49e-05 48 26 7 204 2 PFKFB1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Bos taurus
Q7N900 2.53e-05 47 36 3 92 3 gpmB Probable phosphoglycerate mutase GpmB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P16118 3.36e-05 48 25 7 204 1 PFKFB1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Homo sapiens
D3DFP8 3.57e-05 47 25 8 210 1 pspB Putative phosphoserine phosphatase 2 Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
A8G9J4 6.62e-05 46 24 5 191 3 gpmB Probable phosphoglycerate mutase GpmB Serratia proteamaculans (strain 568)
Q91348 6.77e-05 47 25 7 204 2 None 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Gallus gallus
A7MIJ0 7.7e-05 46 39 1 64 3 gpmB Probable phosphoglycerate mutase GpmB Cronobacter sakazakii (strain ATCC BAA-894)
O60825 7.7e-05 47 28 9 205 1 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Homo sapiens
P70266 0.000114 46 25 7 204 1 Pfkfb1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Mus musculus
P26285 0.000138 46 28 8 204 1 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Bos taurus
P39701 0.00017 45 37 3 91 1 cobC Adenosylcobalamin/alpha-ribazole phosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64956 0.000214 45 32 4 128 4 BQ2027_MB2253C Uncharacterized protein Mb2253c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLH4 0.000214 45 32 4 128 4 MT2287 Uncharacterized protein MT2287 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WLH5 0.000214 45 32 4 128 1 Rv2228c Bifunctional protein Rv2228c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B2VH13 0.000284 44 39 0 51 3 gpmB Probable phosphoglycerate mutase GpmB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q5NVT1 0.000353 45 27 9 205 2 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Pongo abelii
O35552 0.000569 44 25 8 205 2 Pfkfb3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Rattus norvegicus
Q57G26 0.00061 43 35 1 62 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella choleraesuis (strain SC-B67)
Q5R9C1 0.000754 43 25 6 204 2 PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Pongo abelii
A8ALW1 0.000778 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9JJH5 0.000847 43 27 8 207 1 Pfkfb2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Rattus norvegicus
A9MR94 0.000878 43 37 0 48 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZJU8 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TU55 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella schwarzengrund (strain CVM19633)
A9N7F5 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK44 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4I9 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella newport (strain SL254)
B4TH18 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella heidelberg (strain SL476)
B5R9W3 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3B7 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella enteritidis PT4 (strain P125109)
B5FTD9 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella dublin (strain CT_02021853)
B5F543 0.000895 43 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella agona (strain SL483)
Q16875 0.001 43 26 8 205 1 PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Homo sapiens
Q8Z0T4 0.001 42 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella typhi
B5BAL1 0.001 42 38 0 47 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi A (strain AKU_12601)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_04490
Feature type CDS
Gene gpmA
Product 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
Location 229244 - 229996 (strand: 1)
Length 753 (nucleotides) / 250 (amino acids)
In genomic island -

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1549
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00300 Histidine phosphatase superfamily (branch 1)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0588 Carbohydrate transport and metabolism (G) G Phosphoglycerate mutase (BPG-dependent)

Kegg Ortholog Annotation(s)

Protein Sequence

MAVTKLVLVRHGESEWNKENRFTGWTDVELSEKGRAEAQEAGQLLKKEGFSFDFAYTSVLKRAIHTLWNILDQVNQQWLPVEKSWKLNERHYGALQGLDKAETAAKYGDEQVKLWRRGFAITPPALEKSDERFPGHDPRYAKLAESELPATESLAITIDRVVPYWTDVIKPRVASGEKVIIAAHGNSLRALVKYLDNMSEDEILELNIPTAVPLVYEFDENMKPLRRYYLGDQDAIAAKAAAVANQGKAK

Flanking regions ( +/- flanking 50bp)

CTGTTTCAATTCTGAAACCCCCTATCTGAAACACAACAGGAGTTTACGCTATGGCAGTAACTAAACTGGTGCTTGTACGTCACGGTGAAAGTGAGTGGAACAAAGAGAACCGCTTTACCGGCTGGACTGATGTTGAGTTATCTGAAAAAGGCCGTGCTGAAGCACAAGAGGCTGGTCAGTTACTCAAAAAAGAAGGCTTCTCTTTTGATTTCGCCTATACCTCTGTACTGAAACGCGCTATTCACACACTGTGGAATATCCTGGATCAGGTAAACCAGCAGTGGCTGCCGGTTGAGAAAAGCTGGAAACTGAACGAACGCCATTACGGCGCACTCCAGGGTCTGGATAAAGCGGAAACCGCTGCAAAATACGGTGACGAGCAGGTCAAACTGTGGCGTCGCGGTTTTGCCATTACCCCGCCGGCACTGGAAAAAAGTGATGAGCGCTTCCCGGGCCACGATCCGCGTTATGCGAAACTGGCAGAAAGCGAACTGCCTGCCACTGAGAGCCTGGCGATCACTATCGACCGCGTTGTGCCTTACTGGACTGATGTTATCAAACCACGCGTTGCTTCCGGTGAGAAAGTAATCATCGCTGCACACGGTAACTCCCTGCGTGCACTGGTGAAATACCTGGATAACATGAGCGAAGATGAAATCCTCGAGCTGAACATCCCGACCGCAGTGCCGCTGGTGTATGAGTTTGATGAAAACATGAAGCCGCTGCGCCGCTATTACCTGGGCGACCAGGATGCGATTGCTGCCAAAGCCGCTGCTGTTGCTAACCAGGGTAAAGCGAAGTAATCCGCTTTCTTTGGTGAAAAAAACCCTGACAGTGTCAGGGTTTTTTGTTT