Homologs in group_1525

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09850 FBDBKF_09850 56.5 Morganella morganii S1 araC AraC-type DNA-binding domain and AraC-containing proteins
EHELCC_04650 EHELCC_04650 56.5 Morganella morganii S2 araC AraC-type DNA-binding domain and AraC-containing proteins
NLDBIP_04650 NLDBIP_04650 56.5 Morganella morganii S4 araC AraC-type DNA-binding domain and AraC-containing proteins
LHKJJB_13980 LHKJJB_13980 56.5 Morganella morganii S3 araC AraC-type DNA-binding domain and AraC-containing proteins
HKOGLL_12555 HKOGLL_12555 56.5 Morganella morganii S5 araC AraC-type DNA-binding domain and AraC-containing proteins
F4V73_RS00495 F4V73_RS00495 58.5 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_1525

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1525

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76241 1.61e-28 112 32 6 255 2 nimR HTH-type transcriptional regulator NimR Escherichia coli (strain K12)
Q6NI56 6.28e-11 65 37 0 80 3 ripA HTH-type transcriptional regulator RipA Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q8NRR3 1.9e-09 60 32 1 102 2 ripA HTH-type transcriptional regulator RipA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8FQS2 2.19e-07 54 32 0 79 3 ripA HTH-type transcriptional regulator RipA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q6GK93 3.13e-06 50 27 0 81 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q8NYJ9 3.53e-06 50 27 0 81 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 3.53e-06 50 27 0 81 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 3.53e-06 50 27 0 81 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 3.53e-06 50 27 0 81 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 3.53e-06 50 27 0 81 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q7A7X9 3.95e-06 50 27 0 81 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain N315)
Q99X00 3.95e-06 50 27 0 81 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0A9E0 4.04e-06 50 28 4 137 1 araC Arabinose operon regulatory protein Escherichia coli (strain K12)
P0A9E1 4.04e-06 50 28 4 137 3 araC Arabinose operon regulatory protein Escherichia coli O157:H7
Q2YV56 5.38e-06 49 27 0 81 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P11765 6.27e-06 49 28 4 137 3 araC Arabinose operon regulatory protein Citrobacter freundii
P03022 8.91e-06 49 30 4 132 3 araC Arabinose operon regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5HKE0 1.14e-05 48 28 0 77 3 SERP2406 Uncharacterized response regulatory protein SERP2406 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CQE3 2.52e-05 47 28 0 77 3 SE_0165 Uncharacterized response regulatory protein SE_0165 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q936F1 4.47e-05 47 32 1 81 4 None Uncharacterized HTH-type transcriptional regulator Staphylococcus aureus
Q99XB1 5.36e-05 47 32 1 81 4 SAV0101 Uncharacterized HTH-type transcriptional regulator SAV0101 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A882 5.36e-05 47 32 1 81 4 SA0097 Uncharacterized HTH-type transcriptional regulator SA0097 Staphylococcus aureus (strain N315)
Q6GD21 5.41e-05 47 32 1 81 4 SAS0078 Uncharacterized HTH-type transcriptional regulator SAS0078 Staphylococcus aureus (strain MSSA476)
Q8NYT6 5.41e-05 47 32 1 81 4 MW0077 Uncharacterized HTH-type transcriptional regulator MW0077 Staphylococcus aureus (strain MW2)
Q6GKK1 6.03e-05 47 32 1 81 4 SAR0107 Uncharacterized HTH-type transcriptional regulator SAR0107 Staphylococcus aureus (strain MRSA252)
P19219 0.000148 45 35 1 80 1 adaA Bifunctional transcriptional activator/DNA repair enzyme AdaA Bacillus subtilis (strain 168)
Q9I1P2 0.000198 45 30 4 122 4 vqsM HTH-type transcriptional regulator VqsM Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5HJR8 0.000226 45 30 1 81 4 SACOL0084 Uncharacterized HTH-type transcriptional regulator SACOL0084 Staphylococcus aureus (strain COL)
Q66FF1 0.000242 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FN79 0.000242 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P54722 0.000247 45 31 4 119 4 yfiF Uncharacterized HTH-type transcriptional regulator YfiF Bacillus subtilis (strain 168)
A4TRS7 0.000261 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis (strain Pestoides F)
Q1CEB6 0.000261 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYR6 0.000261 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIZ9 0.000261 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis
B2K1W6 0.000261 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0W2 0.000261 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pestis bv. Antiqua (strain Antiqua)
B1JNC4 0.00027 45 33 1 69 3 rhaR HTH-type transcriptional activator RhaR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
O31449 0.000411 44 28 0 81 4 ybfI Uncharacterized HTH-type transcriptional regulator YbfI Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02770
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 607523 - 608284 (strand: 1)
Length 762 (nucleotides) / 253 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1525
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02311 AraC-like ligand binding domain
PF12833 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2207 Transcription (K) K AraC-type DNA-binding domain and AraC-containing proteins

Protein Sequence

MAWLNQYDHFVPEEHLASVVGIAAEMGKHDSGFHSHDRGQLLFTQSGCMRITLASRVSVLPPMRIAWIPPKLEHRVEMYAAVGYRSVYIADKFHHRFPTESEILTISPLLREILERIAIADFDTQWEVGRYANLLAVFLDEIQQAKRQPNHLSMPSDRRLRKLSFDELPPPLQELAQYIGASEKTITRLFYKETGLSYQQWRQQWRLMKAIELLATHHRYLEISQLLGFASDSAFITFFKKMTGQTPQEYLRN

Flanking regions ( +/- flanking 50bp)

TTGTCTTGTTATATATATAAAGACATAATATTTACCAAATAGGACAAGTGATGGCTTGGCTTAATCAATACGACCACTTTGTGCCAGAAGAACACCTTGCATCAGTTGTGGGTATTGCTGCAGAGATGGGAAAACATGATTCAGGTTTTCACTCACATGATAGGGGGCAGTTACTGTTTACTCAATCGGGTTGTATGAGAATTACTTTAGCCTCTCGTGTATCTGTTTTGCCACCCATGAGAATTGCCTGGATCCCGCCAAAACTGGAACATCGAGTCGAGATGTATGCGGCTGTAGGTTATCGTTCAGTTTATATTGCCGATAAATTTCATCATCGTTTCCCAACTGAAAGCGAAATACTGACTATTTCACCTTTACTTAGAGAGATATTAGAGCGTATTGCCATTGCTGATTTTGACACCCAGTGGGAAGTAGGGCGGTATGCAAATTTATTAGCTGTTTTTTTAGATGAAATTCAGCAAGCTAAACGTCAACCTAATCATTTATCAATGCCCAGTGATAGACGGTTAAGAAAATTATCTTTCGATGAATTACCTCCGCCACTACAAGAATTAGCGCAATATATTGGCGCTAGTGAAAAAACCATTACTCGATTATTTTATAAAGAAACAGGATTAAGCTATCAACAATGGCGTCAGCAATGGCGATTAATGAAAGCGATAGAGTTATTAGCCACACATCATCGTTATTTAGAAATTAGTCAATTATTAGGGTTTGCCAGCGATAGTGCCTTTATCACTTTTTTTAAAAAAATGACCGGGCAAACACCACAAGAGTATTTAAGAAATTGATCCATGCTAATAGCATAAAGCCCCGCAAAAACGGGGCTTAGCCAGTCAAT