Homologs in group_1590

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09995 FBDBKF_09995 54.5 Morganella morganii S1 trxA Thiol-disulfide isomerase or thioredoxin
EHELCC_04795 EHELCC_04795 54.5 Morganella morganii S2 trxA Thiol-disulfide isomerase or thioredoxin
NLDBIP_04795 NLDBIP_04795 54.5 Morganella morganii S4 trxA Thiol-disulfide isomerase or thioredoxin
LHKJJB_13835 LHKJJB_13835 54.5 Morganella morganii S3 trxA Thiol-disulfide isomerase or thioredoxin
HKOGLL_12700 HKOGLL_12700 54.5 Morganella morganii S5 trxA Thiol-disulfide isomerase or thioredoxin
F4V73_RS00340 F4V73_RS00340 58.2 Morganella psychrotolerans - protein disulfide oxidoreductase

Distribution of the homologs in the orthogroup group_1590

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1590

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P43787 1.44e-42 142 40 0 164 3 HI_1115 Thioredoxin-like protein HI_1115 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9K1N8 1.97e-11 64 35 3 114 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JWM8 1.97e-11 64 35 3 114 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P14930 6.65e-11 63 34 3 114 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria gonorrhoeae
O31699 5.2e-09 55 31 6 141 1 ykuV Thiol-disulfide oxidoreductase YkuV Bacillus subtilis (strain 168)
Q9XGS0 9.1e-09 55 30 2 110 1 None Thioredoxin M-type, chloroplastic Brassica napus
P12243 2.31e-08 52 25 2 112 3 trxA Thioredoxin 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P37395 4.51e-08 52 27 4 120 3 trxA Thioredoxin Cyanidium caldarium
P0A4L2 6.91e-08 51 25 1 112 1 trxA Thioredoxin 1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A4L1 6.91e-08 51 25 1 112 3 trxA Thioredoxin 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P66928 8.08e-08 51 27 1 100 1 trxA Thioredoxin Helicobacter pylori (strain ATCC 700392 / 26695)
P66929 8.08e-08 51 27 1 100 3 trxA Thioredoxin Helicobacter pylori (strain J99 / ATCC 700824)
P14949 1.98e-07 50 25 2 108 1 trxA Thioredoxin Bacillus subtilis (strain 168)
P50254 2.13e-07 50 29 2 91 3 trxA Thioredoxin Neopyropia yezoensis
P51225 3.2e-07 49 27 2 107 3 trxA Thioredoxin Porphyra purpurea
Q96419 5.74e-07 49 31 1 92 3 None Thioredoxin H-type Fagopyrum esculentum
P52231 7.89e-07 48 25 1 112 1 trxA Thioredoxin Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P43785 1.38e-06 48 21 1 112 3 trxA Thioredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5JMR9 1.67e-06 48 24 2 93 3 Os01g0963400 Thioredoxin Y, chloroplastic Oryza sativa subsp. japonica
P20857 1.84e-06 47 45 1 46 1 trxB Thioredoxin 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8CXF3 2.3e-06 48 24 5 149 3 resA Thiol-disulfide oxidoreductase ResA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8IFW4 2.52e-06 48 24 2 121 1 TrxT Thioredoxin-T Drosophila melanogaster
O48737 2.74e-06 48 27 3 111 1 At1g03680 Thioredoxin M1, chloroplastic Arabidopsis thaliana
P9WG65 3.78e-06 48 30 3 104 1 mpt53 Soluble secreted antigen MPT53 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG64 3.78e-06 48 30 3 104 3 mpt53 Soluble secreted antigen MPT53 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A619 3.78e-06 48 30 3 104 3 mpt53 Soluble secreted antigen MPT53 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P52236 4.34e-06 47 28 2 97 3 ccmG Thiol:disulfide interchange protein DsbE homolog Paracoccus denitrificans (strain Pd 1222)
Q39239 5.58e-06 46 28 1 92 1 TRX4 Thioredoxin H4 Arabidopsis thaliana
Q05739 6.57e-06 46 23 1 116 1 trxA Thioredoxin Streptomyces clavuligerus
O31687 8.47e-06 47 24 4 124 1 stoA Sporulation thiol-disulfide oxidoreductase A Bacillus subtilis (strain 168)
P73263 8.57e-06 45 40 0 45 1 slr1139 Thioredoxin-like protein slr1139 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1RKN1 1.34e-05 45 24 1 100 3 trxA Thioredoxin Rickettsia bellii (strain RML369-C)
P0AGG7 1.34e-05 45 29 2 96 3 trxC Thioredoxin 2 Shigella flexneri
P0AGG4 1.34e-05 45 29 2 96 1 trxC Thioredoxin 2 Escherichia coli (strain K12)
P0AGG5 1.34e-05 45 29 2 96 3 trxC Thioredoxin 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGG6 1.34e-05 45 29 2 96 3 trxC Thioredoxin 2 Escherichia coli O157:H7
O30974 1.55e-05 45 35 1 57 1 trxA Thioredoxin Mycolicibacterium smegmatis
Q9ZP20 1.64e-05 46 26 1 91 2 TRXM Thioredoxin M5, chloroplastic Oryza sativa subsp. japonica
Q4UNK3 1.73e-05 45 24 1 90 3 trxA Thioredoxin Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q1RQJ1 1.8e-05 45 24 2 97 1 None Thioredoxin Asp f 28 Aspergillus fumigatus
P07591 2.25e-05 45 25 1 89 1 None Thioredoxin M-type, chloroplastic Spinacia oleracea
P80579 2.38e-05 44 22 2 108 1 trxA Thioredoxin Alicyclobacillus acidocaldarius subsp. acidocaldarius
Q41864 2.46e-05 45 23 1 105 2 TRM1 Thioredoxin M-type, chloroplastic Zea mays
Q6H7E4 3.05e-05 45 25 1 91 2 Os02g0639900 Thioredoxin M1, chloroplastic Oryza sativa subsp. japonica
P52230 3.06e-05 44 24 3 112 1 trxA Thioredoxin 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9CPM6 4.16e-05 45 29 6 119 3 dsbE Thiol:disulfide interchange protein DsbE Pasteurella multocida (strain Pm70)
P9WG67 4.18e-05 44 36 0 50 1 trxA Thioredoxin Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG66 4.18e-05 44 36 0 50 3 trxA Thioredoxin Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A617 4.18e-05 44 36 0 50 3 trxA Thioredoxin Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P46843 4.29e-05 46 43 0 39 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
P10472 4.76e-05 43 25 2 108 1 trxA Thioredoxin Chlorobaculum thiosulfatiphilum
Q5WGY8 5.38e-05 45 25 1 86 3 resA Probable thiol-disulfide oxidoreductase ResA Shouchella clausii (strain KSM-K16)
P50338 5.49e-05 43 23 2 96 3 trxA Thioredoxin Griffithsia pacifica
Q6HL81 5.82e-05 44 25 5 160 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q9SEU6 5.85e-05 45 25 1 89 2 At3g15360 Thioredoxin M4, chloroplastic Arabidopsis thaliana
Q73B22 5.94e-05 44 25 5 160 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9SEU8 6.65e-05 44 26 1 91 1 TRXM2 Thioredoxin M2, chloroplastic Arabidopsis thaliana
Q8L7S9 7.22e-05 44 24 3 87 2 At1g43560 Thioredoxin Y2, chloroplastic Arabidopsis thaliana
Q42403 7.83e-05 43 24 2 103 1 TRX3 Thioredoxin H3 Arabidopsis thaliana
Q7X8R5 8.14e-05 44 23 1 91 2 Os04g0530600 Thioredoxin M2, chloroplastic Oryza sativa subsp. japonica
P33791 8.39e-05 43 22 1 90 3 trxA Thioredoxin (Fragment) Kitasatospora aureofaciens
O22022 8.45e-05 43 23 2 97 3 trxA Thioredoxin Cyanidioschyzon merolae (strain NIES-3377 / 10D)
Q92JR5 9.31e-05 43 23 1 90 3 trxA Thioredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P52227 9.55e-05 42 27 2 97 3 trxA Thioredoxin Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q39362 0.000122 43 26 1 97 2 THL-2 Thioredoxin H-type 2 Brassica napus
P47370 0.000158 42 27 2 88 3 trxA Thioredoxin Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q1RQI9 0.000162 42 27 2 97 1 None Thioredoxin (Fragment) Malassezia sympodialis
Q9ZP21 0.000182 43 25 1 91 2 None Thioredoxin M-type, chloroplastic Triticum aestivum
P52233 0.000191 42 38 1 47 3 trxA Thioredoxin Acidithiobacillus ferridurans
P75512 0.000197 42 27 3 92 3 trxA Thioredoxin Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P29448 0.000206 42 26 1 90 1 TRX1 Thioredoxin H1 Arabidopsis thaliana
Q6ES52 0.000211 43 24 3 102 2 Os09g0401200 TPR repeat-containing thioredoxin TDX Oryza sativa subsp. japonica
Q7XQQ2 0.000213 43 24 1 91 2 Os04g0430800 Thioredoxin M3, chloroplastic Oryza sativa subsp. japonica
Q6NPF9 0.000224 43 20 1 107 1 At1g76760 Thioredoxin Y1, chloroplastic Arabidopsis thaliana
P00275 0.000251 42 20 2 107 1 None Thioredoxin C-1 Corynebacterium nephridii
Q8KEA4 0.000253 41 24 1 95 3 trx1 Thioredoxin 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q6XHI1 0.000269 41 28 2 95 3 Trx2 Thioredoxin-2 Drosophila yakuba
P52232 0.000286 41 23 1 92 1 slr0233 Thioredoxin-like protein slr0233 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q10057 0.000287 43 34 2 72 3 SPAC1F5.02 Putative protein disulfide-isomerase C1F5.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8XFE5 0.000291 42 28 5 116 3 dsbE1 Thiol:disulfide interchange protein DsbE Salmonella typhi
P48384 0.000352 42 20 1 105 1 None Thioredoxin M-type, chloroplastic Pisum sativum
P0AA30 0.000443 41 23 1 104 3 trxA Thioredoxin 1 Shigella flexneri
P0AA28 0.000443 41 23 1 104 1 trxA Thioredoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA29 0.000443 41 23 1 104 1 trxA Thioredoxin 1 Salmonella typhi
P0AA25 0.000443 41 23 1 104 1 trxA Thioredoxin 1 Escherichia coli (strain K12)
P0AA26 0.000443 41 23 1 104 3 trxA Thioredoxin 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA27 0.000443 41 23 1 104 1 trxA Thioredoxin 1 Escherichia coli O157:H7
P23400 0.00045 42 23 4 106 1 TRXM Thioredoxin M-type, chloroplastic Chlamydomonas reinhardtii
Q8XFK6 0.000488 42 27 5 116 3 dsbE1 Thiol:disulfide interchange protein DsbE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZD52 0.000524 42 28 4 114 3 dsbE Thiol:disulfide interchange protein DsbE Yersinia pestis
Q9ZEE0 0.000652 40 21 1 90 1 trxA Thioredoxin Rickettsia prowazekii (strain Madrid E)
P59527 0.000707 40 23 2 105 3 trxA Thioredoxin Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O94504 0.000723 41 26 1 89 1 trx2 Thioredoxin-2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9I3N1 0.000764 41 26 3 94 1 dsbE Thiol:disulfide interchange protein DsbE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52237 0.001 41 29 3 88 3 dsbE Thiol:disulfide interchange protein DsbE Pseudomonas fluorescens biotype C

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02175
Feature type CDS
Gene -
Product protein disulfide oxidoreductase
Location 509244 - 509747 (strand: 1)
Length 504 (nucleotides) / 167 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1590
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08534 Redoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0526 Posttranslational modification, protein turnover, chaperones (O) O Thiol-disulfide isomerase or thioredoxin

Protein Sequence

MANRLRKWGKELIILALIFVAISFAMDWWRQPTPPELTDLSTLYTVDDKPVSLIALSQEKPLLIYFWASWCGICKLTTPTVNDLAQQGYNVTSVVIRSGDDAKIIRGINSKQLVFPVINDDRGAISQRWGISATPSFVILYKGEMVHFTSGWTSSWGLKLRLWWASI

Flanking regions ( +/- flanking 50bp)

GATCAGTTAGAAATTATTGTGAAAGAACAACTGGCGAAAGTGAAAAAATAATGGCAAATCGTTTACGAAAATGGGGTAAAGAATTAATTATTCTCGCCCTTATTTTTGTGGCTATTTCATTTGCTATGGACTGGTGGCGTCAACCAACGCCACCAGAACTTACTGATTTATCTACGCTTTATACAGTTGATGATAAACCAGTCTCATTGATTGCCCTTAGCCAAGAGAAACCATTACTGATCTATTTTTGGGCGAGTTGGTGTGGCATTTGTAAGTTAACTACACCGACGGTAAATGATTTAGCACAACAGGGTTATAATGTTACGTCTGTAGTTATCCGCTCTGGTGATGATGCCAAAATAATACGTGGCATTAACTCCAAGCAACTAGTTTTTCCGGTTATTAATGATGATAGAGGGGCTATTTCTCAACGTTGGGGGATAAGTGCTACACCTTCTTTTGTTATTCTCTATAAAGGTGAAATGGTGCACTTTACAAGTGGCTGGACATCCTCTTGGGGATTAAAACTTAGGTTATGGTGGGCTTCAATTTAACTTGTTTATCAGAGTTTAAATGAAGAAAAAATAATGCCAGGTAGGCTGAT