Homologs in group_1590

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09995 FBDBKF_09995 100.0 Morganella morganii S1 trxA Thiol-disulfide isomerase or thioredoxin
EHELCC_04795 EHELCC_04795 100.0 Morganella morganii S2 trxA Thiol-disulfide isomerase or thioredoxin
NLDBIP_04795 NLDBIP_04795 100.0 Morganella morganii S4 trxA Thiol-disulfide isomerase or thioredoxin
LHKJJB_13835 LHKJJB_13835 100.0 Morganella morganii S3 trxA Thiol-disulfide isomerase or thioredoxin
F4V73_RS00340 F4V73_RS00340 81.4 Morganella psychrotolerans - protein disulfide oxidoreductase
PMI_RS02175 PMI_RS02175 54.5 Proteus mirabilis HI4320 - protein disulfide oxidoreductase

Distribution of the homologs in the orthogroup group_1590

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1590

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P43787 1.05e-36 127 35 2 165 3 HI_1115 Thioredoxin-like protein HI_1115 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P80579 1.56e-08 53 26 2 121 1 trxA Thioredoxin Alicyclobacillus acidocaldarius subsp. acidocaldarius
O31699 2.83e-08 53 26 3 109 1 ykuV Thiol-disulfide oxidoreductase YkuV Bacillus subtilis (strain 168)
Q05739 5.26e-08 51 27 2 104 1 trxA Thioredoxin Streptomyces clavuligerus
P52236 9.63e-08 52 34 2 90 3 ccmG Thiol:disulfide interchange protein DsbE homolog Paracoccus denitrificans (strain Pd 1222)
P36893 1.23e-07 52 27 5 154 3 helX Thiol:disulfide interchange protein HelX Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P14930 1.83e-07 53 28 6 139 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria gonorrhoeae
Q9JWM8 2.32e-07 52 28 6 139 1 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K1N8 2.53e-07 52 30 5 120 3 msrAB Peptide methionine sulfoxide reductase MsrA/MsrB Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9SEU6 2.82e-07 51 28 1 89 2 At3g15360 Thioredoxin M4, chloroplastic Arabidopsis thaliana
Q41864 6.37e-07 50 30 1 89 2 TRM1 Thioredoxin M-type, chloroplastic Zea mays
P9WG65 7.69e-07 50 27 2 114 1 mpt53 Soluble secreted antigen MPT53 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG64 7.69e-07 50 27 2 114 3 mpt53 Soluble secreted antigen MPT53 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A619 7.69e-07 50 27 2 114 3 mpt53 Soluble secreted antigen MPT53 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q73B22 9.13e-07 49 25 8 158 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8CXF3 1.19e-06 49 26 5 148 3 resA Thiol-disulfide oxidoreductase ResA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
O22022 1.77e-06 47 26 2 96 3 trxA Thioredoxin Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P46843 2.64e-06 49 47 0 40 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
P20857 3.4e-06 47 52 1 40 1 trxB Thioredoxin 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P00275 3.46e-06 47 25 1 96 1 None Thioredoxin C-1 Corynebacterium nephridii
O81332 3.75e-06 48 28 2 100 2 None Thioredoxin F-type, chloroplastic Mesembryanthemum crystallinum
Q6HL81 3.97e-06 48 25 8 158 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis subsp. konkukian (strain 97-27)
P50254 4.2e-06 46 27 2 102 3 trxA Thioredoxin Neopyropia yezoensis
Q7X8R5 4.56e-06 47 32 3 89 2 Os04g0530600 Thioredoxin M2, chloroplastic Oryza sativa subsp. japonica
Q9XGS0 4.73e-06 47 30 1 89 1 None Thioredoxin M-type, chloroplastic Brassica napus
Q9PAN4 5.13e-06 48 28 2 100 3 dsbE Thiol:disulfide interchange protein DsbE Xylella fastidiosa (strain 9a5c)
P52230 5.31e-06 46 27 3 108 1 trxA Thioredoxin 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q81SZ9 7.16e-06 47 25 7 158 1 resA Thiol-disulfide oxidoreductase ResA Bacillus anthracis
A0RBT0 7.16e-06 47 25 7 158 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis (strain Al Hakam)
P0A4L3 7.43e-06 45 27 2 104 3 trxA Thioredoxin Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4L4 7.43e-06 45 27 2 104 3 trxA Thioredoxin Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P9WG67 7.46e-06 46 25 2 107 1 trxA Thioredoxin Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG66 7.46e-06 46 25 2 107 3 trxA Thioredoxin Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A617 7.46e-06 46 25 2 107 3 trxA Thioredoxin Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P66928 7.8e-06 45 27 1 100 1 trxA Thioredoxin Helicobacter pylori (strain ATCC 700392 / 26695)
P66929 7.8e-06 45 27 1 100 3 trxA Thioredoxin Helicobacter pylori (strain J99 / ATCC 700824)
P0A4L2 8.55e-06 45 25 1 96 1 trxA Thioredoxin 1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A4L1 8.55e-06 45 25 1 96 3 trxA Thioredoxin 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q81FU5 8.66e-06 47 27 6 123 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6H7E4 8.93e-06 47 29 1 89 2 Os02g0639900 Thioredoxin M1, chloroplastic Oryza sativa subsp. japonica
P33791 9.39e-06 45 24 1 107 3 trxA Thioredoxin (Fragment) Kitasatospora aureofaciens
Q87BH3 1e-05 47 28 2 100 3 dsbE Thiol:disulfide interchange protein DsbE Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P0AA30 1.3e-05 45 25 3 113 3 trxA Thioredoxin 1 Shigella flexneri
P0AA28 1.3e-05 45 25 3 113 1 trxA Thioredoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA29 1.3e-05 45 25 3 113 1 trxA Thioredoxin 1 Salmonella typhi
P0AA25 1.3e-05 45 25 3 113 1 trxA Thioredoxin 1 Escherichia coli (strain K12)
P0AA26 1.3e-05 45 25 3 113 3 trxA Thioredoxin 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA27 1.3e-05 45 25 3 113 1 trxA Thioredoxin 1 Escherichia coli O157:H7
P14949 1.48e-05 45 27 3 111 1 trxA Thioredoxin Bacillus subtilis (strain 168)
Q1RQJ1 1.52e-05 45 26 1 96 1 None Thioredoxin Asp f 28 Aspergillus fumigatus
O30974 1.73e-05 45 42 0 40 1 trxA Thioredoxin Mycolicibacterium smegmatis
P12243 1.93e-05 45 26 1 91 3 trxA Thioredoxin 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q1RQI9 1.95e-05 44 24 2 94 1 None Thioredoxin (Fragment) Malassezia sympodialis
P52231 2.18e-05 44 24 1 107 1 trxA Thioredoxin Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P10472 2.2e-05 44 29 3 96 1 trxA Thioredoxin Chlorobaculum thiosulfatiphilum
O94504 2.22e-05 45 28 1 90 1 trx2 Thioredoxin-2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P73263 2.38e-05 44 53 0 28 1 slr1139 Thioredoxin-like protein slr1139 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P37395 2.47e-05 44 26 1 96 3 trxA Thioredoxin Cyanidium caldarium
Q9ZP21 2.99e-05 45 28 1 89 2 None Thioredoxin M-type, chloroplastic Triticum aestivum
Q4UNK3 3.07e-05 44 25 1 89 3 trxA Thioredoxin Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P43785 3.15e-05 44 22 2 112 3 trxA Thioredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P51225 3.72e-05 44 28 2 91 3 trxA Thioredoxin Porphyra purpurea
P10473 3.89e-05 43 27 2 97 1 trxA Thioredoxin Rhodospirillum rubrum
Q9ZP20 4.22e-05 45 28 1 89 2 TRXM Thioredoxin M5, chloroplastic Oryza sativa subsp. japonica
P48384 4.31e-05 45 26 1 89 1 None Thioredoxin M-type, chloroplastic Pisum sativum
O48737 4.58e-05 45 28 1 89 1 At1g03680 Thioredoxin M1, chloroplastic Arabidopsis thaliana
P07887 4.84e-05 43 42 1 49 1 None Thioredoxin C-2 Corynebacterium nephridii
Q8S091 5.6e-05 45 23 1 99 2 Os01g0913000 Thioredoxin F, chloroplastic Oryza sativa subsp. japonica
P52237 5.69e-05 44 37 3 89 3 dsbE Thiol:disulfide interchange protein DsbE Pseudomonas fluorescens biotype C
O31820 6.34e-05 44 26 7 175 3 yneN Thioredoxin-like protein YneN Bacillus subtilis (strain 168)
O31687 6.97e-05 44 23 5 140 1 stoA Sporulation thiol-disulfide oxidoreductase A Bacillus subtilis (strain 168)
Q8L7S9 8.11e-05 44 24 2 90 2 At1g43560 Thioredoxin Y2, chloroplastic Arabidopsis thaliana
P9WIE1 8.23e-05 44 28 7 150 1 bcp Putative peroxiredoxin Rv2521 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE0 8.23e-05 44 28 7 150 3 bcp Putative peroxiredoxin MT2597 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P47370 8.32e-05 43 46 1 43 3 trxA Thioredoxin Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P50338 9.98e-05 43 23 1 107 3 trxA Thioredoxin Griffithsia pacifica
P52233 0.000102 43 23 2 107 3 trxA Thioredoxin Acidithiobacillus ferridurans
Q8KEA4 0.000125 42 33 1 57 3 trx1 Thioredoxin 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
G4NFB7 0.000128 43 26 1 96 1 TRX2 Thioredoxin-2 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P50413 0.000134 42 29 1 99 3 TXN Thioredoxin Ovis aries
Q92JR5 0.000156 42 24 1 89 3 trxA Thioredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8XFK6 0.000156 43 29 6 138 3 dsbE1 Thiol:disulfide interchange protein DsbE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P08058 0.000183 42 25 3 129 1 trxA Thioredoxin Cereibacter sphaeroides
P29450 0.000189 43 25 3 118 2 None Thioredoxin F-type, chloroplastic Pisum sativum
P07591 0.000257 43 26 1 89 1 None Thioredoxin M-type, chloroplastic Spinacia oleracea
Q9I3N1 0.000278 42 31 3 99 1 dsbE Thiol:disulfide interchange protein DsbE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1RKN1 0.000318 41 23 1 89 3 trxA Thioredoxin Rickettsia bellii (strain RML369-C)
P75512 0.000347 41 26 3 90 3 trxA Thioredoxin Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q5KXL9 0.00035 42 25 5 124 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus kaustophilus (strain HTA426)
Q39362 0.000359 41 25 1 95 2 THL-2 Thioredoxin H-type 2 Brassica napus
P30960 0.00038 42 25 6 158 1 cycY Thiol:disulfide interchange protein CycY Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q68Y00 0.00041 41 22 2 111 3 trxA Thioredoxin Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9KCJ4 0.000523 42 23 6 117 3 resA Thiol-disulfide oxidoreductase ResA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P21195 0.000549 42 31 1 63 2 P4HB Protein disulfide-isomerase Oryctolagus cuniculus
P0AGG7 0.000573 41 24 2 91 3 trxC Thioredoxin 2 Shigella flexneri
P0AGG4 0.000573 41 24 2 91 1 trxC Thioredoxin 2 Escherichia coli (strain K12)
P0AGG5 0.000573 41 24 2 91 3 trxC Thioredoxin 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGG6 0.000573 41 24 2 91 3 trxC Thioredoxin 2 Escherichia coli O157:H7
Q9CM49 0.000578 40 26 4 113 3 trxA Thioredoxin Pasteurella multocida (strain Pm70)
Q9XFH8 0.000592 42 27 2 100 1 At3g02730 Thioredoxin F1, chloroplastic Arabidopsis thaliana
Q9ZEE0 0.000604 40 23 1 89 1 trxA Thioredoxin Rickettsia prowazekii (strain Madrid E)
Q8XFE5 0.000651 42 28 6 138 3 dsbE1 Thiol:disulfide interchange protein DsbE Salmonella typhi
Q5JMR9 0.000692 41 28 3 88 3 Os01g0963400 Thioredoxin Y, chloroplastic Oryza sativa subsp. japonica
Q9XFH9 0.000718 42 25 2 100 1 At5g16400 Thioredoxin F2, chloroplastic Arabidopsis thaliana
P09856 0.000759 41 23 2 100 1 None Thioredoxin F-type, chloroplastic Spinacia oleracea
A4IQF5 0.00089 41 24 5 131 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus thermodenitrificans (strain NG80-2)
P57653 0.001 40 22 1 101 3 trxA Thioredoxin Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12700
Feature type CDS
Gene trxA
Product Thiol-disulfide isomerase or thioredoxin
Location 93087 - 93593 (strand: -1)
Length 507 (nucleotides) / 168 (amino acids)
In genomic island -

Contig

Accession ZDB_690
Length 144397 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1590
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08534 Redoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0526 Posttranslational modification, protein turnover, chaperones (O) O Thiol-disulfide isomerase or thioredoxin

Protein Sequence

MRLLRRWGKEFLLLLVILFIASQAMDYWRKPQAPDLNTVPSLTLTDGTPVSIAQMSAEKPLLVYFWASWCGICKLTSPSVSELSESGYNVVTVAIRSGEDDRLAKGMAAKGYYFPVINDPDGRISQLWGVNVTPTFVIYHKGEIVSYTSGWTSQLGMMARLWLAKLSV

Flanking regions ( +/- flanking 50bp)

GAAGCACAGCTGGATGCCATCATTAAGGAACAGCTGGCTAAGGTTAAATAATGCGGTTACTGCGCAGATGGGGAAAGGAATTTCTCCTGCTGCTGGTGATTTTATTTATTGCGTCACAGGCGATGGACTACTGGCGCAAACCGCAGGCACCGGATTTAAACACGGTGCCTTCGCTGACACTGACAGATGGCACACCGGTGTCCATTGCGCAGATGAGTGCGGAAAAACCGCTGCTGGTCTACTTCTGGGCATCCTGGTGCGGGATCTGCAAACTGACCTCGCCGTCAGTCAGCGAACTGTCTGAGTCTGGCTACAATGTGGTGACGGTTGCTATCCGCTCCGGTGAAGATGACCGGCTGGCGAAAGGGATGGCAGCGAAAGGTTACTATTTTCCGGTGATTAATGATCCGGATGGCCGTATCTCTCAGCTCTGGGGTGTGAATGTCACGCCGACTTTTGTGATTTATCACAAAGGGGAGATAGTCAGTTACACCAGCGGCTGGACCAGTCAGTTGGGGATGATGGCACGGTTGTGGCTGGCGAAGTTATCAGTCTGAAATGAAAAATCCCGCGGTGAGCAGAGCAATCACGGCGGGATTTTTTTATC