Homologs in group_1548

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10025 FBDBKF_10025 83.9 Morganella morganii S1 gltK glutamate/aspartate ABC transporter permease GltK
EHELCC_04825 EHELCC_04825 83.9 Morganella morganii S2 gltK glutamate/aspartate ABC transporter permease GltK
NLDBIP_04825 NLDBIP_04825 83.9 Morganella morganii S4 gltK glutamate/aspartate ABC transporter permease GltK
LHKJJB_13805 LHKJJB_13805 83.9 Morganella morganii S3 gltK glutamate/aspartate ABC transporter permease GltK
HKOGLL_12730 HKOGLL_12730 83.9 Morganella morganii S5 gltK glutamate/aspartate ABC transporter permease GltK
F4V73_RS00310 F4V73_RS00310 83.9 Morganella psychrotolerans gltK glutamate/aspartate ABC transporter permease GltK

Distribution of the homologs in the orthogroup group_1548

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1548

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AER5 4.64e-139 391 84 0 223 1 gltK Glutamate/aspartate import permease protein GltK Escherichia coli (strain K12)
P0AER6 4.64e-139 391 84 0 223 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AER7 4.64e-139 391 84 0 223 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O157:H7
P54536 1.36e-42 146 36 1 206 1 artQ Arginine transport system permease protein ArtQ Bacillus subtilis (strain 168)
P0AFT4 3.97e-38 135 40 2 214 3 tcyL L-cystine transport system permease protein TcyL Shigella flexneri
P0AFT2 3.97e-38 135 40 2 214 1 tcyL L-cystine transport system permease protein TcyL Escherichia coli (strain K12)
P0AFT3 3.97e-38 135 40 2 214 3 tcyL L-cystine transport system permease protein TcyL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42200 2.14e-34 125 38 4 210 1 tcyB L-cystine transport system permease protein TcyB Bacillus subtilis (strain 168)
O34671 2.98e-32 119 33 1 206 2 glnM Probable glutamine ABC transporter permease protein GlnM Bacillus subtilis (strain 168)
O34606 3.73e-30 114 32 5 216 2 glnP Probable glutamine ABC transporter permease protein GlnP Bacillus subtilis (strain 168)
P45768 4.91e-27 109 34 4 210 1 yhdY Inner membrane amino-acid ABC transporter permease protein YhdY Escherichia coli (strain K12)
P41083 1.14e-26 105 29 2 215 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia prowazekii (strain Madrid E)
Q68XN8 1.28e-26 105 30 2 212 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UKC4 3.26e-26 103 28 1 212 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P42399 7.72e-26 103 29 2 221 3 yckA Probable amino-acid ABC transporter permease protein YckA Bacillus subtilis (strain 168)
Q92J96 1.01e-25 102 28 1 212 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P48245 4.35e-25 102 25 1 208 1 gluD Glutamate transport system permease protein GluD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q52814 1.01e-24 103 29 3 212 3 aapM General L-amino acid transport system permease protein AapM Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P0AER3 2.38e-24 99 27 2 198 1 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli (strain K12)
P0AER4 2.38e-24 99 27 2 198 3 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8RQL4 2.42e-24 100 25 1 208 3 gluD Glutamate transport system permease protein GluD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P0AEQ9 3e-24 99 30 2 220 3 glnP Glutamine transport system permease protein GlnP Shigella flexneri
P0AEQ6 3e-24 99 30 2 220 1 glnP Glutamine transport system permease protein GlnP Escherichia coli (strain K12)
P0AEQ7 3e-24 99 30 2 220 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ8 3e-24 99 30 2 220 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O157:H7
Q1RHC0 3.58e-24 98 27 1 212 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia bellii (strain RML369-C)
P54953 5.95e-23 95 29 1 221 1 yxeN Probable amino-acid permease protein YxeN Bacillus subtilis (strain 168)
Q52665 1.22e-22 98 31 3 209 3 bztC Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8NQU3 1.36e-21 94 34 4 194 1 argU Arginine transport system permease protein ArgU Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P52625 6.76e-21 90 32 1 181 3 patM Probable amino-acid ABC transporter permease protein PatM Vibrio harveyi
Q52664 7.1e-21 93 33 2 181 3 bztB Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q52664 0.000755 43 37 4 88 3 bztB Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O34931 3.88e-20 88 28 1 212 1 tcyM L-cystine transport system permease protein TcyM Bacillus subtilis (strain 168)
P35113 5.46e-20 88 31 2 215 3 nocM Nopaline transport system permease protein NocM Agrobacterium fabrum (strain C58 / ATCC 33970)
P0AE36 1.87e-19 86 25 3 219 3 artQ Arginine ABC transporter permease protein ArtQ Shigella flexneri
P0AE34 1.87e-19 86 25 3 219 1 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli (strain K12)
P0AE35 1.87e-19 86 25 3 219 3 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P55661 1.83e-18 84 26 4 233 3 NGR_a01520 Probable amino-acid ABC transporter permease protein y4tG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P35114 2.39e-18 84 28 2 216 2 occM Octopine transport system permease protein OccM Rhizobium radiobacter
P55660 9.85e-18 82 28 6 225 3 NGR_a01530 Probable amino-acid ABC transporter permease protein y4tF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P48244 1.89e-17 81 31 5 184 1 gluC Glutamate transport system permease protein GluC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q52813 3.1e-17 82 32 0 127 3 aapQ General L-amino acid transport system permease protein AapQ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P45023 3.48e-17 80 32 6 216 3 HI_1079 Probable amino-acid ABC transporter permease protein HI_0179 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P72296 3.65e-17 80 29 3 208 3 occM Octopine transport system permease protein OccM Rhizobium meliloti
P0A2I9 7.3e-17 79 23 2 210 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J0 7.3e-17 79 23 2 210 3 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhi
Q8RQL5 8.87e-17 79 30 5 184 3 gluC Glutamate transport system permease protein GluC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P45767 2.75e-16 80 35 1 128 3 yhdX Putative amino-acid ABC transporter permease protein YhdX Escherichia coli (strain K12)
O34315 4.04e-16 77 26 1 206 1 tcyL L-cystine transport system permease protein TcyL Bacillus subtilis (strain 168)
P52094 4.5e-16 77 23 2 210 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Escherichia coli (strain K12)
P0A2I7 1.8e-15 75 28 1 207 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2I8 1.8e-15 75 28 1 207 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhi
P45090 6.19e-15 74 29 3 187 3 artQ Arginine ABC transporter permease protein ArtQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AEU6 1.91e-14 73 26 2 224 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Shigella flexneri
P0AEU3 1.91e-14 73 26 2 224 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli (strain K12)
P0AEU4 1.91e-14 73 26 2 224 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU5 1.91e-14 73 26 2 224 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O157:H7
P0AE33 1.11e-12 68 24 6 216 3 artM Arginine ABC transporter permease protein ArtM Shigella flexneri
P0AE30 1.11e-12 68 24 6 216 1 artM Arginine ABC transporter permease protein ArtM Escherichia coli (strain K12)
P0AE31 1.11e-12 68 24 6 216 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE32 1.11e-12 68 24 6 216 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O157:H7
P72295 2.25e-12 67 24 3 207 3 occQ Octopine transport system permease protein OccQ Rhizobium meliloti
P35118 2.29e-12 67 27 3 175 3 nocQ Nopaline transport system permease protein NocQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A4N5 2.13e-11 64 25 4 208 2 occQ Octopine transport system permease protein OccQ Rhizobium radiobacter
P0A4N6 2.13e-11 64 25 4 208 3 occQ Octopine transport system permease protein OccQ Agrobacterium tumefaciens (strain Ach5)
P45089 3.05e-07 52 25 1 112 3 artM Arginine ABC transporter permease protein ArtM Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8Z991 1.77e-05 47 29 1 99 3 metI D-methionine transport system permease protein MetI Salmonella typhi
P31547 1.93e-05 47 29 1 99 1 metI D-methionine transport system permease protein MetI Escherichia coli (strain K12)
Q8X800 1.93e-05 47 29 1 99 3 metI D-methionine transport system permease protein MetI Escherichia coli O157:H7
Q8ZRN0 5.04e-05 46 28 1 99 3 metI D-methionine transport system permease protein MetI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZH39 0.000331 43 26 1 99 3 metI D-methionine transport system permease protein MetI Yersinia pestis

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02145
Feature type CDS
Gene gltK
Product glutamate/aspartate ABC transporter permease GltK
Location 503224 - 503898 (strand: -1)
Length 675 (nucleotides) / 224 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1548
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0765 Amino acid transport and metabolism (E) E ABC-type amino acid transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10002 glutamate/aspartate transport system permease protein ABC transporters
Two-component system		 -

Protein Sequence

MYEFDWSSVVPSLPFLMDGMVITLKITITAIVIGILWGTILAVMRLSTFKPISWFAAAYVNTFRSIPLVMVLLWFYLIVPNILQNVLGLSPKSDIRLISAMVAFSLFEAAYYSEIIRAGIQSISKGQFSASLALGMTKSQTMRLVILPQAFRAMIPLLLTQGIVLFQDTSLVYVLSLTDFFRTAANIGERDGTQVEMILFAGFVYFIISFSASMLVNFLKKRTT

Flanking regions ( +/- flanking 50bp)

CACTGGTTAGAAAAACGGGTGCGTTTACCTGGCACAGCAGGAGGTCAATAATGTACGAGTTTGACTGGAGTTCTGTTGTTCCTAGCCTACCTTTTTTAATGGATGGCATGGTCATTACTTTAAAAATCACCATAACAGCAATTGTTATCGGTATTTTATGGGGAACAATACTTGCAGTGATGCGCTTATCTACTTTTAAGCCCATCAGTTGGTTTGCGGCCGCTTACGTTAATACCTTTCGTTCTATTCCTTTAGTGATGGTATTACTGTGGTTCTATTTAATTGTGCCTAACATATTACAAAATGTTCTAGGCCTTTCACCAAAAAGTGATATCCGTTTAATTTCAGCAATGGTAGCGTTCTCTCTATTTGAAGCTGCTTATTACTCTGAAATCATCAGAGCAGGTATACAAAGCATCAGTAAAGGCCAGTTTTCAGCATCCTTAGCTTTAGGAATGACAAAATCACAAACGATGCGTTTAGTGATTTTACCTCAAGCATTTCGTGCCATGATCCCTTTATTGCTCACACAAGGTATCGTTTTATTTCAAGATACCTCACTCGTGTATGTATTAAGTCTGACCGACTTTTTCCGAACAGCGGCAAATATTGGTGAGCGTGATGGCACACAGGTTGAAATGATCCTTTTTGCTGGTTTTGTCTACTTTATAATTAGTTTCTCCGCTTCAATGTTAGTGAACTTTCTTAAAAAAAGGACTACTTAGATGATTTCCCTAAAAGATGTATCCAAATGGTATGGTCAGTTTCAAGTGCT