Homologs in group_1548

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10025 FBDBKF_10025 100.0 Morganella morganii S1 gltK glutamate/aspartate ABC transporter permease GltK
EHELCC_04825 EHELCC_04825 100.0 Morganella morganii S2 gltK glutamate/aspartate ABC transporter permease GltK
NLDBIP_04825 NLDBIP_04825 100.0 Morganella morganii S4 gltK glutamate/aspartate ABC transporter permease GltK
HKOGLL_12730 HKOGLL_12730 100.0 Morganella morganii S5 gltK glutamate/aspartate ABC transporter permease GltK
F4V73_RS00310 F4V73_RS00310 94.2 Morganella psychrotolerans gltK glutamate/aspartate ABC transporter permease GltK
PMI_RS02145 PMI_RS02145 83.9 Proteus mirabilis HI4320 gltK glutamate/aspartate ABC transporter permease GltK

Distribution of the homologs in the orthogroup group_1548

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1548

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AER5 6.48e-131 370 79 0 223 1 gltK Glutamate/aspartate import permease protein GltK Escherichia coli (strain K12)
P0AER6 6.48e-131 370 79 0 223 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AER7 6.48e-131 370 79 0 223 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O157:H7
P54536 1.4e-38 135 36 3 206 1 artQ Arginine transport system permease protein ArtQ Bacillus subtilis (strain 168)
P0AFT4 1.66e-35 128 37 2 214 3 tcyL L-cystine transport system permease protein TcyL Shigella flexneri
P0AFT2 1.66e-35 128 37 2 214 1 tcyL L-cystine transport system permease protein TcyL Escherichia coli (strain K12)
P0AFT3 1.66e-35 128 37 2 214 3 tcyL L-cystine transport system permease protein TcyL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42200 1.77e-31 118 36 4 210 1 tcyB L-cystine transport system permease protein TcyB Bacillus subtilis (strain 168)
P45768 9.22e-28 111 34 3 208 1 yhdY Inner membrane amino-acid ABC transporter permease protein YhdY Escherichia coli (strain K12)
P54953 4.92e-27 106 33 1 221 1 yxeN Probable amino-acid permease protein YxeN Bacillus subtilis (strain 168)
O34606 5.01e-27 106 30 5 213 2 glnP Probable glutamine ABC transporter permease protein GlnP Bacillus subtilis (strain 168)
P0AEQ9 5.13e-27 106 30 2 220 3 glnP Glutamine transport system permease protein GlnP Shigella flexneri
P0AEQ6 5.13e-27 106 30 2 220 1 glnP Glutamine transport system permease protein GlnP Escherichia coli (strain K12)
P0AEQ7 5.13e-27 106 30 2 220 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ8 5.13e-27 106 30 2 220 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O157:H7
P42399 1.47e-25 102 28 2 221 3 yckA Probable amino-acid ABC transporter permease protein YckA Bacillus subtilis (strain 168)
O34671 1.73e-25 102 31 1 206 2 glnM Probable glutamine ABC transporter permease protein GlnM Bacillus subtilis (strain 168)
P0AER3 1.84e-25 102 30 2 190 1 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli (strain K12)
P0AER4 1.84e-25 102 30 2 190 3 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q52665 4.36e-25 105 35 4 209 3 bztC Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P48245 1.99e-24 100 25 1 208 1 gluD Glutamate transport system permease protein GluD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P41083 7.08e-24 97 25 2 214 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia prowazekii (strain Madrid E)
Q52814 7.26e-24 100 28 3 212 3 aapM General L-amino acid transport system permease protein AapM Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8RQL4 2.08e-23 98 25 1 208 3 gluD Glutamate transport system permease protein GluD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P52625 3.49e-23 96 33 1 176 3 patM Probable amino-acid ABC transporter permease protein PatM Vibrio harveyi
Q68XN8 4.44e-23 95 25 2 214 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UKC4 1.37e-22 94 24 1 214 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q1RHC0 1.8e-22 94 27 3 211 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia bellii (strain RML369-C)
Q92J96 2.6e-22 94 26 2 214 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8NQU3 8.59e-22 94 35 4 194 1 argU Arginine transport system permease protein ArgU Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P35113 1.09e-20 90 32 1 214 3 nocM Nopaline transport system permease protein NocM Agrobacterium fabrum (strain C58 / ATCC 33970)
Q52664 1e-19 90 40 1 122 3 bztB Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O34315 1.2e-19 87 29 1 206 1 tcyL L-cystine transport system permease protein TcyL Bacillus subtilis (strain 168)
P35114 1.42e-19 87 30 3 208 2 occM Octopine transport system permease protein OccM Rhizobium radiobacter
P72296 2.24e-19 86 31 3 203 3 occM Octopine transport system permease protein OccM Rhizobium meliloti
O34931 2.45e-19 86 28 1 212 1 tcyM L-cystine transport system permease protein TcyM Bacillus subtilis (strain 168)
P48244 3.97e-18 82 32 2 170 1 gluC Glutamate transport system permease protein GluC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P55661 7.48e-18 82 25 3 224 3 NGR_a01520 Probable amino-acid ABC transporter permease protein y4tG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q52813 1.6e-17 83 34 0 127 3 aapQ General L-amino acid transport system permease protein AapQ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P0A2I9 2.35e-17 80 27 4 211 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J0 2.35e-17 80 27 4 211 3 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhi
P55660 5.79e-17 80 29 6 223 3 NGR_a01530 Probable amino-acid ABC transporter permease protein y4tF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8RQL5 8.1e-17 79 31 2 170 3 gluC Glutamate transport system permease protein GluC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P52094 1.29e-16 79 26 4 211 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Escherichia coli (strain K12)
P45023 2.62e-16 77 31 5 206 3 HI_1079 Probable amino-acid ABC transporter permease protein HI_0179 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45767 4.23e-16 79 35 1 128 3 yhdX Putative amino-acid ABC transporter permease protein YhdX Escherichia coli (strain K12)
P0AE36 6.38e-16 77 26 4 217 3 artQ Arginine ABC transporter permease protein ArtQ Shigella flexneri
P0AE34 6.38e-16 77 26 4 217 1 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli (strain K12)
P0AE35 6.38e-16 77 26 4 217 3 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A2I7 7.46e-16 77 26 1 219 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2I8 7.46e-16 77 26 1 219 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhi
P0AEU6 3.21e-14 72 25 2 212 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Shigella flexneri
P0AEU3 3.21e-14 72 25 2 212 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli (strain K12)
P0AEU4 3.21e-14 72 25 2 212 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU5 3.21e-14 72 25 2 212 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O157:H7
P45090 2.24e-12 67 28 1 164 3 artQ Arginine ABC transporter permease protein ArtQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P72295 4.31e-12 66 24 4 211 3 occQ Octopine transport system permease protein OccQ Rhizobium meliloti
P35118 2.3e-11 64 28 4 178 3 nocQ Nopaline transport system permease protein NocQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A4N5 8.36e-11 63 25 5 217 2 occQ Octopine transport system permease protein OccQ Rhizobium radiobacter
P0A4N6 8.36e-11 63 25 5 217 3 occQ Octopine transport system permease protein OccQ Agrobacterium tumefaciens (strain Ach5)
P0AE33 9.43e-11 62 22 5 218 3 artM Arginine ABC transporter permease protein ArtM Shigella flexneri
P0AE30 9.43e-11 62 22 5 218 1 artM Arginine ABC transporter permease protein ArtM Escherichia coli (strain K12)
P0AE31 9.43e-11 62 22 5 218 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE32 9.43e-11 62 22 5 218 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O157:H7
P31547 2.27e-06 50 29 5 128 1 metI D-methionine transport system permease protein MetI Escherichia coli (strain K12)
P45089 2.34e-06 50 20 1 115 3 artM Arginine ABC transporter permease protein ArtM Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8X800 3.7e-06 49 28 5 128 3 metI D-methionine transport system permease protein MetI Escherichia coli O157:H7
Q8Z991 7.88e-06 48 29 5 128 3 metI D-methionine transport system permease protein MetI Salmonella typhi
Q8ZH39 1.28e-05 48 28 5 128 3 metI D-methionine transport system permease protein MetI Yersinia pestis
Q8ZRN0 2.34e-05 47 28 5 128 3 metI D-methionine transport system permease protein MetI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_13805
Feature type CDS
Gene gltK
Product glutamate/aspartate ABC transporter permease GltK
Location 44678 - 45355 (strand: -1)
Length 678 (nucleotides) / 225 (amino acids)

Contig

Accession ZDB_371
Length 143607 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1548
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0765 Amino acid transport and metabolism (E) E ABC-type amino acid transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10002 glutamate/aspartate transport system permease protein ABC transporters
Two-component system		 -

Protein Sequence

MYEFDWSSVMPGMPFLLQGLVITAKITVTAIVIGILWGTILAMMRLSSIKIVSWLAALYVNAFRSVPLVMVLLWFYLIVPNLVQNVLGISPKTDIRLISAMVAFSLFEAAYYAEIIRAGIQSVSRGQTSASLALGMTKMQTMRLVVLPQAFRAMIPLLLTQGIVLFQDTSLVYVLSLTDFFRTASNIGERDGTQIEMVLFAGAVYFVISFGASMLVNYLKRRTVS

Flanking regions ( +/- flanking 50bp)

ATGCATTTACTGGAAAAACGGGTGCGTCTGCCCGGGACAGGAGGCCACTGATGTACGAATTTGACTGGAGTTCGGTGATGCCGGGTATGCCGTTCCTGTTACAGGGGCTGGTTATTACGGCGAAAATCACGGTTACAGCGATTGTTATCGGCATCCTGTGGGGCACGATACTGGCTATGATGCGTCTGTCATCCATAAAGATTGTGAGCTGGCTGGCTGCCCTCTATGTGAACGCCTTCCGCTCCGTTCCGCTGGTGATGGTGCTGTTGTGGTTCTATCTGATTGTGCCTAACTTAGTCCAAAATGTTCTTGGCATATCACCAAAAACAGATATCCGTCTGATCTCAGCCATGGTAGCGTTTTCCCTGTTTGAAGCTGCGTATTATGCTGAAATTATCCGCGCCGGGATTCAGAGTGTGTCACGGGGACAAACATCCGCCTCACTCGCCCTCGGTATGACCAAAATGCAGACCATGCGTCTGGTGGTTCTGCCGCAGGCATTCCGCGCGATGATCCCGCTGCTGCTGACCCAGGGAATCGTCCTGTTCCAGGATACCTCGCTGGTGTATGTGCTCAGCCTGACCGATTTCTTCCGCACCGCCAGCAATATCGGCGAGCGTGACGGAACACAAATCGAAATGGTGCTGTTTGCGGGTGCGGTTTATTTTGTTATCAGCTTTGGTGCGTCAATGCTGGTTAATTATCTCAAGAGAAGGACTGTGTCATGATCTCCCTGAAAAATATCTCCAAATGGTACGGTCAGTTCCATGTCTTAACC