Homologs in group_1612

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10140 FBDBKF_10140 50.0 Morganella morganii S1 nrdH Glutaredoxin
EHELCC_04940 EHELCC_04940 50.0 Morganella morganii S2 nrdH Glutaredoxin
NLDBIP_04940 NLDBIP_04940 50.0 Morganella morganii S4 nrdH Glutaredoxin
LHKJJB_13690 LHKJJB_13690 50.0 Morganella morganii S3 nrdH Glutaredoxin
HKOGLL_12845 HKOGLL_12845 50.0 Morganella morganii S5 nrdH Glutaredoxin
F4V73_RS00200 F4V73_RS00200 50.7 Morganella psychrotolerans nrdH glutaredoxin-like protein NrdH

Distribution of the homologs in the orthogroup group_1612

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1612

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q56108 5.39e-17 70 43 0 72 3 nrdH Glutaredoxin-like protein NrdH Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AC68 1.2e-16 70 38 0 72 3 nrdH Glutaredoxin-like protein NrdH Shigella flexneri
P0AC65 1.2e-16 70 38 0 72 1 nrdH Glutaredoxin-like protein NrdH Escherichia coli (strain K12)
P0AC66 1.2e-16 70 38 0 72 3 nrdH Glutaredoxin-like protein NrdH Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC67 1.2e-16 70 38 0 72 3 nrdH Glutaredoxin-like protein NrdH Escherichia coli O157:H7
Q48708 1.09e-12 60 30 0 71 1 nrdH Glutaredoxin-like protein NrdH Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CGW5 1.78e-12 59 30 0 71 3 nrdH Glutaredoxin-like protein NrdH Lactococcus lactis subsp. lactis (strain IL1403)
O34342 6.97e-05 40 31 3 80 3 yosR SPbeta prophage-derived thioredoxin-like protein YosR Bacillus subtilis (strain 168)
Q05266 0.000336 38 32 3 73 4 56 Gene 56 protein Mycobacterium phage L5

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02050
Feature type CDS
Gene nrdH
Product glutaredoxin-like protein NrdH
Location 485170 - 485394 (strand: -1)
Length 225 (nucleotides) / 74 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1612
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00462 Glutaredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0695 Posttranslational modification, protein turnover, chaperones (O) O Glutaredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06191 glutaredoxin-like protein NrdH - -

Protein Sequence

MSVILYTKPNCVQCSATERALQQQKIPFTAVDLTQDTQALAKIVSMGYRQVPVVVNGDEHWSGFCPDKIRQIAR

Flanking regions ( +/- flanking 50bp)

TTCATTGTGACTGTGAGCAGACACATTCACATTTTTATAAGGGTTATTCTATGTCTGTGATCCTCTATACCAAACCAAATTGTGTTCAATGCAGTGCAACCGAGCGCGCATTACAACAACAAAAAATTCCTTTCACTGCGGTTGATCTCACCCAAGACACTCAAGCATTAGCAAAAATAGTTTCTATGGGATATCGCCAAGTACCAGTTGTCGTTAATGGTGACGAACATTGGTCTGGCTTCTGCCCAGATAAAATTCGTCAAATAGCGCGCTAAAGGAGCAACTTATGCAATCGACTGCCCCTTTAATTTATTTCTCTAGTCGC