Homologs in group_1613

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10145 FBDBKF_10145 68.2 Morganella morganii S1 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
EHELCC_04945 EHELCC_04945 68.2 Morganella morganii S2 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
NLDBIP_04945 NLDBIP_04945 68.2 Morganella morganii S4 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
LHKJJB_13685 LHKJJB_13685 68.2 Morganella morganii S3 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
HKOGLL_12850 HKOGLL_12850 68.2 Morganella morganii S5 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
F4V73_RS00195 F4V73_RS00195 68.4 Morganella psychrotolerans nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI

Distribution of the homologs in the orthogroup group_1613

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1613

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A6TCU0 8.14e-56 173 61 1 126 3 nrdI Protein NrdI Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XVD7 1.46e-55 172 62 1 126 3 nrdI Protein NrdI Klebsiella pneumoniae (strain 342)
Q8UJ69 6.63e-55 171 63 2 129 3 nrdI Protein NrdI Agrobacterium fabrum (strain C58 / ATCC 33970)
C6DC61 6.98e-55 171 61 1 128 3 nrdI Protein NrdI Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D1W1 8.5e-55 171 61 1 128 3 nrdI Protein NrdI Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GI78 1.22e-54 170 62 1 128 3 nrdI Protein NrdI Serratia proteamaculans (strain 568)
Q2K3W4 1.47e-54 170 62 1 127 3 nrdI Protein NrdI Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A1JKB8 2.07e-54 170 64 1 128 3 nrdI Protein NrdI Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A6X357 2.23e-54 169 61 1 127 3 nrdI Protein NrdI Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B1JR56 2.36e-54 169 64 1 128 3 nrdI Protein NrdI Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667N6 2.36e-54 169 64 1 128 3 nrdI Protein NrdI Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZDC6 2.36e-54 169 64 1 128 3 nrdI Protein NrdI Yersinia pestis
B2KAB9 2.36e-54 169 64 1 128 3 nrdI Protein NrdI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFL7 2.36e-54 169 64 1 128 3 nrdI Protein NrdI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N772 3.79e-54 169 65 1 128 3 nrdI Protein NrdI Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8Z4E6 5.17e-54 169 59 1 131 3 nrdI Protein NrdI Salmonella typhi
B4TSY7 9.14e-54 168 60 1 128 3 nrdI Protein NrdI Salmonella schwarzengrund (strain CVM19633)
A9N099 9.14e-54 168 60 1 128 3 nrdI Protein NrdI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TEZ3 9.14e-54 168 60 1 128 3 nrdI Protein NrdI Salmonella heidelberg (strain SL476)
B5QUL6 9.14e-54 168 60 1 128 3 nrdI Protein NrdI Salmonella enteritidis PT4 (strain P125109)
Q56109 1.55e-53 167 60 1 128 3 nrdI Protein NrdI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0PWK6 1.55e-53 167 60 1 128 3 nrdI Protein NrdI Salmonella paratyphi C (strain RKS4594)
Q57KW6 1.55e-53 167 60 1 128 3 nrdI Protein NrdI Salmonella choleraesuis (strain SC-B67)
B5F333 1.55e-53 167 60 1 128 3 nrdI Protein NrdI Salmonella agona (strain SL483)
A9MG06 2.32e-53 167 59 1 128 3 nrdI Protein NrdI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1MBD4 2.89e-53 167 62 1 128 3 nrdI Protein NrdI Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B5FSW2 3.67e-53 166 59 1 128 3 nrdI Protein NrdI Salmonella dublin (strain CT_02021853)
B2VDV1 3.75e-53 166 60 1 128 3 nrdI Protein NrdI Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B4T381 5.88e-53 166 59 1 128 3 nrdI Protein NrdI Salmonella newport (strain SL254)
B5ZRN9 1.08e-52 165 60 1 127 3 nrdI Protein NrdI Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A8ANN2 1.2e-52 165 60 1 126 3 nrdI Protein NrdI Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7M9B7 1.9e-52 165 59 1 126 3 nrdI Protein NrdI Escherichia coli O8 (strain IAI1)
B7LE91 1.9e-52 165 59 1 126 3 nrdI Protein NrdI Escherichia coli (strain 55989 / EAEC)
A7ZQA5 1.9e-52 165 59 1 126 3 nrdI Protein NrdI Escherichia coli O139:H28 (strain E24377A / ETEC)
B3Q0Y6 2.67e-52 164 59 1 127 3 nrdI Protein NrdI Rhizobium etli (strain CIAT 652)
Q1R824 3.54e-52 164 58 1 126 3 nrdI Protein NrdI Escherichia coli (strain UTI89 / UPEC)
A1AEL9 3.54e-52 164 58 1 126 3 nrdI Protein NrdI Escherichia coli O1:K1 / APEC
B7MKE7 3.54e-52 164 58 1 126 3 nrdI Protein NrdI Escherichia coli O45:K1 (strain S88 / ExPEC)
C5BUY7 4.64e-52 164 64 2 131 3 nrdI Protein NrdI Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
B7NSF9 7.7e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A775 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Shigella flexneri
Q0T1A7 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Shigella flexneri serotype 5b (strain 8401)
B2U069 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LW06 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LPE9 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli (strain SMS-3-5 / SECEC)
B6I665 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli (strain SE11)
P0A772 7.96e-52 163 58 1 126 1 nrdI Protein NrdI Escherichia coli (strain K12)
B1IUZ9 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A773 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEK1 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A3F6 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli O9:H4 (strain HS)
B1XCL1 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli (strain K12 / DH10B)
C4ZYS6 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli (strain K12 / MC4100 / BW2952)
B7MYX8 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli O81 (strain ED1a)
B5Z288 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A774 7.96e-52 163 58 1 126 3 nrdI Protein NrdI Escherichia coli O157:H7
Q31X44 1.21e-51 163 57 1 126 3 nrdI Protein NrdI Shigella boydii serotype 4 (strain Sb227)
B7N6R0 1.52e-51 162 58 1 126 3 nrdI Protein NrdI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P65547 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella suis biovar 1 (strain 1330)
A9WY13 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VU41 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P65546 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RKP1 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella melitensis biotype 2 (strain ATCC 23457)
A9ME65 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q577C7 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella abortus biovar 1 (strain 9-941)
Q2YJZ2 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella abortus (strain 2308)
B2SBS5 1.7e-51 162 59 1 127 3 nrdI Protein NrdI Brucella abortus (strain S19)
B5BEM1 2.16e-51 162 58 1 128 3 nrdI Protein NrdI Salmonella paratyphi A (strain AKU_12601)
Q5PF04 2.16e-51 162 58 1 128 3 nrdI Protein NrdI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B7UH94 2.9e-51 162 58 1 126 3 nrdI Protein NrdI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32CQ1 3.38e-51 162 57 1 126 3 nrdI Protein NrdI Shigella dysenteriae serotype 1 (strain Sd197)
B5RDD6 4.25e-51 161 59 2 128 3 nrdI Protein NrdI Salmonella gallinarum (strain 287/91 / NCTC 13346)
A4WDN8 2.27e-50 159 57 1 126 3 nrdI Protein NrdI Enterobacter sp. (strain 638)
C0ZXH4 5.02e-50 159 60 3 133 3 nrdI Protein NrdI Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q0S2M1 3.52e-49 157 57 2 133 3 nrdI Protein NrdI Rhodococcus jostii (strain RHA1)
A1T6Q8 9.11e-49 156 57 1 135 3 nrdI Protein NrdI Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A4TDU4 8.83e-48 153 56 1 133 3 nrdI Protein NrdI Mycolicibacterium gilvum (strain PYR-GCK)
Q1R0L8 1.62e-47 152 56 1 124 3 nrdI Protein NrdI Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
P9WIZ3 2.23e-47 152 56 1 130 1 nrdI Protein NrdI Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIZ2 2.23e-47 152 56 1 130 3 nrdI Protein NrdI Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U766 2.23e-47 152 56 1 130 3 nrdI Protein NrdI Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AGH0 2.23e-47 152 56 1 130 3 nrdI Protein NrdI Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KN49 2.23e-47 152 56 1 130 3 nrdI Protein NrdI Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65549 2.23e-47 152 56 1 130 3 nrdI Protein NrdI Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1BB09 8.8e-47 151 55 2 135 3 nrdI Protein NrdI Mycobacterium sp. (strain MCS)
A1UE06 8.8e-47 151 55 2 135 3 nrdI Protein NrdI Mycobacterium sp. (strain KMS)
A3PXF8 8.8e-47 151 55 2 135 3 nrdI Protein NrdI Mycobacterium sp. (strain JLS)
Q73VB3 1.02e-46 150 54 2 137 3 nrdI Protein NrdI Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QJJ4 1.02e-46 150 54 2 137 3 nrdI Protein NrdI Mycobacterium avium (strain 104)
Q1GJB3 1.63e-45 147 52 1 129 3 nrdI Protein NrdI Ruegeria sp. (strain TM1040)
A7MI07 1.79e-45 147 61 1 126 3 nrdI Protein NrdI Cronobacter sakazakii (strain ATCC BAA-894)
Q9CBP9 3.61e-45 146 54 1 130 3 nrdI Protein NrdI Mycobacterium leprae (strain TN)
B8ZS49 3.61e-45 146 54 1 130 3 nrdI Protein NrdI Mycobacterium leprae (strain Br4923)
C1B1P5 4.65e-45 147 55 2 136 3 nrdI Protein NrdI Rhodococcus opacus (strain B4)
A1BA96 8.74e-45 145 56 1 127 3 nrdI Protein NrdI Paracoccus denitrificans (strain Pd 1222)
P75460 9.96e-45 146 52 2 135 3 nrdI Protein NrdI Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q6MSC4 3.43e-44 144 55 2 128 3 nrdI Protein NrdI Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q1J861 5.07e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M4 (strain MGAS10750)
B5XK14 7.19e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M49 (strain NZ131)
P0DC71 7.19e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RG55 7.19e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JN60 7.19e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JD89 7.19e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65551 7.19e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDK5 7.19e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DC70 7.19e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48V07 8.2e-44 144 59 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q98Q29 1.33e-43 143 54 2 128 3 nrdI Protein NrdI Mycoplasmopsis pulmonis (strain UAB CTIP)
P47472 2.34e-43 142 53 2 131 3 nrdI Protein NrdI Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q1JIB1 3.39e-43 142 58 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M2 (strain MGAS10270)
B1ME21 9.3e-43 141 52 2 144 3 nrdI Protein NrdI Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q2ST19 9.48e-43 141 53 2 128 3 nrdI Protein NrdI Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q9A176 1.22e-42 141 58 2 120 3 nrdI Protein NrdI Streptococcus pyogenes serotype M1
Q9XD64 2.35e-42 139 52 3 129 3 nrdI Protein NrdI Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QGT2 2.35e-42 139 52 3 129 3 nrdI Protein NrdI Corynebacterium glutamicum (strain R)
Q6F0T6 2.31e-41 137 51 2 128 3 nrdI Protein NrdI Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
B8DVW3 3.37e-41 136 48 1 133 3 nrdI Protein NrdI Bifidobacterium animalis subsp. lactis (strain AD011)
Q8EWW3 1.64e-40 135 50 3 140 3 nrdI Protein NrdI Malacoplasma penetrans (strain HF-2)
A9IML0 2.75e-40 134 55 1 125 3 nrdI Protein NrdI Bartonella tribocorum (strain CIP 105476 / IBS 506)
O69272 6.8e-40 133 50 3 128 3 nrdI Protein NrdI Corynebacterium ammoniagenes
Q6G5I3 1.63e-39 132 53 1 126 3 nrdI Protein NrdI Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q8D1U5 9.85e-39 130 49 1 126 3 nrdI Protein NrdI Wigglesworthia glossinidia brevipalpis
Q6G0R4 1.85e-37 127 52 1 126 3 nrdI Protein NrdI Bartonella quintana (strain Toulouse)
A1URS1 1.24e-35 122 51 1 125 3 nrdI Protein NrdI Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q9XC21 3.4e-35 121 47 2 129 3 nrdI Protein NrdI Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q48709 1.94e-17 76 34 2 121 3 nrdI Protein NrdI Lactococcus lactis subsp. cremoris (strain MG1363)
Q02ZM3 4.53e-17 75 34 2 121 3 nrdI Protein NrdI Lactococcus lactis subsp. cremoris (strain SK11)
P68525 4.85e-17 74 35 4 117 3 nrdIB Phage protein nrdI Bacillus phage SPbeta
P68524 4.85e-17 74 35 4 117 3 nrdIB SPbeta prophage-derived protein NrdI Bacillus subtilis (strain 168)
Q49VS8 8.57e-17 74 38 5 125 3 nrdI Protein NrdI Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9CGW6 3.77e-16 72 33 2 121 3 nrdI Protein NrdI Lactococcus lactis subsp. lactis (strain IL1403)
A7Z504 5.09e-16 72 38 3 113 3 nrdI Protein NrdI Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P68814 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain MW2)
P0C1S2 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus
A8Z002 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBA0 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain MSSA476)
Q6GIR1 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain MRSA252)
P68812 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain N315)
P68811 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QF39 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain Newman)
Q5HHU1 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain COL)
Q2YSJ9 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IQT4 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain JH9)
Q2G079 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIR0 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain USA300)
A6TZK9 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain JH1)
A7WZL9 2.16e-15 70 36 5 125 3 nrdI Protein NrdI Staphylococcus aureus (strain Mu3 / ATCC 700698)
P50618 2.32e-15 70 38 3 113 1 nrdI Protein NrdI Bacillus subtilis (strain 168)
B9DK28 3.72e-15 70 32 5 131 3 nrdI Protein NrdI Staphylococcus carnosus (strain TM300)
Q65JA6 6.19e-14 67 38 4 114 3 nrdI Protein NrdI Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B9EAC8 9.37e-14 66 36 3 115 3 nrdI Protein NrdI Macrococcus caseolyticus (strain JCSC5402)
Q4L4F3 1.66e-13 65 33 5 127 3 nrdI Protein NrdI Staphylococcus haemolyticus (strain JCSC1435)
Q8CQ03 4.44e-13 64 32 5 125 3 nrdI Protein NrdI Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR00 4.44e-13 64 32 5 125 3 nrdI Protein NrdI Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0DC73 4.7e-10 57 32 4 133 3 SPs1706 Putative NrdI-like protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC72 4.7e-10 57 32 4 133 3 SpyM3_1706 Putative NrdI-like protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q5X9T2 7.61e-10 57 32 4 133 3 M6_Spy1696 Putative NrdI-like protein Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XX2 8.45e-10 56 32 4 133 3 SPy_1984 Putative NrdI-like protein Streptococcus pyogenes serotype M1
Q8DRF4 1.64e-08 53 29 2 120 4 spr0156 Putative NrdI-like protein Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97T03 1.64e-08 53 29 2 120 1 SP_0158 Putative NrdI-like protein Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9RZL8 3.91e-08 52 27 4 123 3 nrdI Protein NrdI Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8NZA2 1.07e-07 51 30 4 133 3 spyM18_2048 Putative NrdI-like protein Streptococcus pyogenes serotype M18 (strain MGAS8232)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02045
Feature type CDS
Gene nrdI
Product class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
Location 484754 - 485158 (strand: -1)
Length 405 (nucleotides) / 134 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1613
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07972 NrdI Flavodoxin like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1780 Nucleotide transport and metabolism (F) F Flavodoxin NrdI, NrdF-interacting activator of class Ib ribonucleotide reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03647 protein involved in ribonucleotide reduction - -

Protein Sequence

MQSTAPLIYFSSRSENCHRFVQKLNLQATRIKEDEPLQATQPFVLLCPTYGGGGVKGAVPKAVIQFLNIPENRQLIRGVIASGNTNFGSAYGLAGDIIAQKCQVPFLYRFELLGTPEDVKRVKTGLSTFWSASK

Flanking regions ( +/- flanking 50bp)

GGCTTCTGCCCAGATAAAATTCGTCAAATAGCGCGCTAAAGGAGCAACTTATGCAATCGACTGCCCCTTTAATTTATTTCTCTAGTCGCTCAGAAAATTGTCACCGCTTCGTACAAAAACTTAATCTACAAGCGACAAGGATAAAAGAGGATGAACCACTACAAGCCACACAACCTTTTGTGTTGCTCTGCCCAACTTATGGTGGCGGTGGCGTTAAAGGCGCAGTGCCTAAAGCGGTGATCCAGTTTTTAAATATTCCTGAAAATCGCCAATTAATACGCGGTGTTATTGCTTCAGGAAATACCAATTTTGGCTCTGCTTACGGCTTAGCAGGTGACATTATTGCACAAAAATGCCAAGTCCCTTTTCTCTATCGTTTTGAGTTACTTGGTACGCCTGAAGATGTTAAACGTGTAAAAACCGGATTAAGCACATTTTGGTCAGCTAGCAAATAATGACTAAAAAGTGAATGAGATAAAAAATATGACCCACTCTATAGAACAAC