Homologs in group_1613

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10145 FBDBKF_10145 100.0 Morganella morganii S1 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
EHELCC_04945 EHELCC_04945 100.0 Morganella morganii S2 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
NLDBIP_04945 NLDBIP_04945 100.0 Morganella morganii S4 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
LHKJJB_13685 LHKJJB_13685 100.0 Morganella morganii S3 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
F4V73_RS00195 F4V73_RS00195 86.2 Morganella psychrotolerans nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
PMI_RS02045 PMI_RS02045 68.2 Proteus mirabilis HI4320 nrdI class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI

Distribution of the homologs in the orthogroup group_1613

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1613

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GI78 1.18e-58 181 66 1 130 3 nrdI Protein NrdI Serratia proteamaculans (strain 568)
C6DC61 5.42e-58 179 65 1 130 3 nrdI Protein NrdI Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A6X357 3.53e-57 177 60 1 129 3 nrdI Protein NrdI Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P65547 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella suis biovar 1 (strain 1330)
A9WY13 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VU41 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P65546 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RKP1 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella melitensis biotype 2 (strain ATCC 23457)
A9ME65 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q577C7 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella abortus biovar 1 (strain 9-941)
Q2YJZ2 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella abortus (strain 2308)
B2SBS5 8.76e-57 176 62 1 129 3 nrdI Protein NrdI Brucella abortus (strain S19)
B4TSY7 1.13e-56 176 59 1 134 3 nrdI Protein NrdI Salmonella schwarzengrund (strain CVM19633)
A9N099 1.13e-56 176 59 1 134 3 nrdI Protein NrdI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TEZ3 1.13e-56 176 59 1 134 3 nrdI Protein NrdI Salmonella heidelberg (strain SL476)
B5QUL6 1.13e-56 176 59 1 134 3 nrdI Protein NrdI Salmonella enteritidis PT4 (strain P125109)
B5FSW2 1.31e-56 176 59 1 134 3 nrdI Protein NrdI Salmonella dublin (strain CT_02021853)
Q8Z4E6 1.55e-56 175 59 1 134 3 nrdI Protein NrdI Salmonella typhi
B7UH94 1.58e-56 175 60 1 133 3 nrdI Protein NrdI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32CQ1 1.74e-56 175 60 1 133 3 nrdI Protein NrdI Shigella dysenteriae serotype 1 (strain Sd197)
Q1R824 1.78e-56 175 60 1 133 3 nrdI Protein NrdI Escherichia coli (strain UTI89 / UPEC)
A1AEL9 1.78e-56 175 60 1 133 3 nrdI Protein NrdI Escherichia coli O1:K1 / APEC
B7MKE7 1.78e-56 175 60 1 133 3 nrdI Protein NrdI Escherichia coli O45:K1 (strain S88 / ExPEC)
B1JR56 2.13e-56 175 64 1 130 3 nrdI Protein NrdI Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667N6 2.13e-56 175 64 1 130 3 nrdI Protein NrdI Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZDC6 2.13e-56 175 64 1 130 3 nrdI Protein NrdI Yersinia pestis
B2KAB9 2.13e-56 175 64 1 130 3 nrdI Protein NrdI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFL7 2.13e-56 175 64 1 130 3 nrdI Protein NrdI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q56109 2.48e-56 175 61 1 129 3 nrdI Protein NrdI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0PWK6 2.48e-56 175 61 1 129 3 nrdI Protein NrdI Salmonella paratyphi C (strain RKS4594)
Q57KW6 2.48e-56 175 61 1 129 3 nrdI Protein NrdI Salmonella choleraesuis (strain SC-B67)
B5F333 2.48e-56 175 61 1 129 3 nrdI Protein NrdI Salmonella agona (strain SL483)
Q6D1W1 2.48e-56 175 64 1 130 3 nrdI Protein NrdI Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JKB8 3.12e-56 174 63 1 130 3 nrdI Protein NrdI Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7M9B7 3.26e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O8 (strain IAI1)
B7LE91 3.26e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli (strain 55989 / EAEC)
A7ZQA5 3.26e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O139:H28 (strain E24377A / ETEC)
B4T381 3.29e-56 174 61 1 129 3 nrdI Protein NrdI Salmonella newport (strain SL254)
Q31X44 4.19e-56 174 60 1 133 3 nrdI Protein NrdI Shigella boydii serotype 4 (strain Sb227)
B7NSF9 4.52e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A775 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Shigella flexneri
Q0T1A7 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Shigella flexneri serotype 5b (strain 8401)
B2U069 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LW06 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LPE9 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli (strain SMS-3-5 / SECEC)
B6I665 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli (strain SE11)
P0A772 4.83e-56 174 60 1 133 1 nrdI Protein NrdI Escherichia coli (strain K12)
B1IUZ9 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A773 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEK1 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A3F6 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O9:H4 (strain HS)
B1XCL1 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli (strain K12 / DH10B)
C4ZYS6 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli (strain K12 / MC4100 / BW2952)
B7MYX8 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O81 (strain ED1a)
B5Z288 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A774 4.83e-56 174 60 1 133 3 nrdI Protein NrdI Escherichia coli O157:H7
A9MG06 7.16e-56 174 58 1 134 3 nrdI Protein NrdI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8ANN2 1.02e-55 173 59 1 129 3 nrdI Protein NrdI Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7N6R0 2.92e-55 172 60 1 129 3 nrdI Protein NrdI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5RDD6 3.08e-55 172 59 2 134 3 nrdI Protein NrdI Salmonella gallinarum (strain 287/91 / NCTC 13346)
A4WDN8 3.58e-55 172 58 1 134 3 nrdI Protein NrdI Enterobacter sp. (strain 638)
B5BEM1 5.87e-55 171 61 1 129 3 nrdI Protein NrdI Salmonella paratyphi A (strain AKU_12601)
Q5PF04 5.87e-55 171 61 1 129 3 nrdI Protein NrdI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C0ZXH4 3.94e-53 167 56 2 139 3 nrdI Protein NrdI Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q7N772 1.07e-52 166 59 1 138 3 nrdI Protein NrdI Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BUY7 2.16e-52 165 62 2 135 3 nrdI Protein NrdI Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
B5XVD7 3.08e-52 164 58 1 129 3 nrdI Protein NrdI Klebsiella pneumoniae (strain 342)
B2VDV1 3.83e-52 164 55 1 133 3 nrdI Protein NrdI Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q1MBD4 4.19e-52 164 57 1 130 3 nrdI Protein NrdI Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A6TCU0 5.26e-52 164 57 1 129 3 nrdI Protein NrdI Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q73VB3 1.7e-51 163 56 1 137 3 nrdI Protein NrdI Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QJJ4 1.7e-51 163 56 1 137 3 nrdI Protein NrdI Mycobacterium avium (strain 104)
Q8UJ69 2.42e-51 162 60 1 129 3 nrdI Protein NrdI Agrobacterium fabrum (strain C58 / ATCC 33970)
A7MI07 2.76e-51 162 67 2 129 3 nrdI Protein NrdI Cronobacter sakazakii (strain ATCC BAA-894)
Q2K3W4 4.18e-51 161 57 1 129 3 nrdI Protein NrdI Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P9WIZ3 5.54e-51 162 56 1 135 1 nrdI Protein NrdI Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIZ2 5.54e-51 162 56 1 135 3 nrdI Protein NrdI Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U766 5.54e-51 162 56 1 135 3 nrdI Protein NrdI Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AGH0 5.54e-51 162 56 1 135 3 nrdI Protein NrdI Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KN49 5.54e-51 162 56 1 135 3 nrdI Protein NrdI Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65549 5.54e-51 162 56 1 135 3 nrdI Protein NrdI Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q0S2M1 1.33e-50 161 54 2 139 3 nrdI Protein NrdI Rhodococcus jostii (strain RHA1)
B5ZRN9 6.59e-50 158 55 1 129 3 nrdI Protein NrdI Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A1T6Q8 1.15e-49 158 55 1 140 3 nrdI Protein NrdI Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B3Q0Y6 1.43e-49 157 55 1 129 3 nrdI Protein NrdI Rhizobium etli (strain CIAT 652)
C1B1P5 1.78e-47 153 52 3 142 3 nrdI Protein NrdI Rhodococcus opacus (strain B4)
B1ME21 5.82e-47 152 52 2 141 3 nrdI Protein NrdI Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q9CBP9 6.03e-47 151 51 1 138 3 nrdI Protein NrdI Mycobacterium leprae (strain TN)
B8ZS49 6.03e-47 151 51 1 138 3 nrdI Protein NrdI Mycobacterium leprae (strain Br4923)
Q1BB09 8.33e-47 151 53 3 139 3 nrdI Protein NrdI Mycobacterium sp. (strain MCS)
A1UE06 8.33e-47 151 53 3 139 3 nrdI Protein NrdI Mycobacterium sp. (strain KMS)
A3PXF8 8.33e-47 151 53 3 139 3 nrdI Protein NrdI Mycobacterium sp. (strain JLS)
A4TDU4 2.13e-46 150 52 1 135 3 nrdI Protein NrdI Mycolicibacterium gilvum (strain PYR-GCK)
Q1GJB3 5.15e-45 146 53 1 128 3 nrdI Protein NrdI Ruegeria sp. (strain TM1040)
Q1R0L8 3.11e-43 141 56 1 120 3 nrdI Protein NrdI Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8D1U5 1.94e-42 140 46 1 134 3 nrdI Protein NrdI Wigglesworthia glossinidia brevipalpis
A1BA96 3.98e-42 139 51 1 136 3 nrdI Protein NrdI Paracoccus denitrificans (strain Pd 1222)
Q6MSC4 1.24e-41 138 49 2 134 3 nrdI Protein NrdI Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q8EWW3 1.93e-41 137 47 2 140 3 nrdI Protein NrdI Malacoplasma penetrans (strain HF-2)
Q2ST19 2.37e-40 135 47 2 134 3 nrdI Protein NrdI Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6F0T6 3.23e-40 134 48 2 128 3 nrdI Protein NrdI Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q1J861 4.02e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q48V07 7.09e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M28 (strain MGAS6180)
B5XK14 7.32e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M49 (strain NZ131)
P0DC71 7.32e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RG55 7.32e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JN60 7.32e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JD89 7.32e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65551 7.32e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDK5 7.32e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DC70 7.32e-40 134 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1JIB1 1.2e-39 133 52 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M2 (strain MGAS10270)
B8DVW3 2.77e-39 132 46 1 140 3 nrdI Protein NrdI Bifidobacterium animalis subsp. lactis (strain AD011)
Q98Q29 3.53e-39 132 48 2 129 3 nrdI Protein NrdI Mycoplasmopsis pulmonis (strain UAB CTIP)
P47472 4.71e-39 132 48 2 130 3 nrdI Protein NrdI Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9A176 1.08e-38 131 51 2 125 3 nrdI Protein NrdI Streptococcus pyogenes serotype M1
P75460 1.69e-38 130 50 2 131 3 nrdI Protein NrdI Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9XD64 3.68e-38 129 44 2 138 3 nrdI Protein NrdI Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QGT2 3.68e-38 129 44 2 138 3 nrdI Protein NrdI Corynebacterium glutamicum (strain R)
O69272 2.25e-37 127 46 2 130 3 nrdI Protein NrdI Corynebacterium ammoniagenes
A1URS1 3.72e-37 126 47 1 127 3 nrdI Protein NrdI Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q6G5I3 6.52e-37 125 46 1 127 3 nrdI Protein NrdI Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A9IML0 8.76e-37 125 48 1 127 3 nrdI Protein NrdI Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q9XC21 2.97e-35 122 43 2 131 3 nrdI Protein NrdI Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q6G0R4 3.28e-35 121 47 1 127 3 nrdI Protein NrdI Bartonella quintana (strain Toulouse)
Q02ZM3 7.41e-19 80 36 2 129 3 nrdI Protein NrdI Lactococcus lactis subsp. cremoris (strain SK11)
Q49VS8 5.19e-18 77 40 4 125 3 nrdI Protein NrdI Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q48709 1.06e-17 77 35 2 129 3 nrdI Protein NrdI Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CGW6 3.34e-17 75 35 2 122 3 nrdI Protein NrdI Lactococcus lactis subsp. lactis (strain IL1403)
Q8CQ03 1.17e-13 66 34 5 115 3 nrdI Protein NrdI Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR00 1.17e-13 66 34 5 115 3 nrdI Protein NrdI Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9DK28 1.18e-13 66 30 5 134 3 nrdI Protein NrdI Staphylococcus carnosus (strain TM300)
B9EAC8 5.42e-13 64 36 3 113 3 nrdI Protein NrdI Macrococcus caseolyticus (strain JCSC5402)
P50618 9.45e-13 63 36 3 113 1 nrdI Protein NrdI Bacillus subtilis (strain 168)
P68525 2.8e-12 62 29 4 117 3 nrdIB Phage protein nrdI Bacillus phage SPbeta
P68524 2.8e-12 62 29 4 117 3 nrdIB SPbeta prophage-derived protein NrdI Bacillus subtilis (strain 168)
P68814 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain MW2)
P0C1S2 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus
A8Z002 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBA0 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain MSSA476)
Q6GIR1 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain MRSA252)
P68812 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain N315)
P68811 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QF39 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain Newman)
Q5HHU1 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain COL)
Q2YSJ9 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IQT4 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain JH9)
Q2G079 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIR0 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain USA300)
A6TZK9 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain JH1)
A7WZL9 5.92e-12 62 33 5 139 3 nrdI Protein NrdI Staphylococcus aureus (strain Mu3 / ATCC 700698)
A7Z504 9.25e-12 61 35 3 113 3 nrdI Protein NrdI Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q65JA6 2.8e-10 57 34 3 113 3 nrdI Protein NrdI Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q4L4F3 8.76e-10 56 30 4 134 3 nrdI Protein NrdI Staphylococcus haemolyticus (strain JCSC1435)
Q9RZL8 2.2e-09 55 37 3 103 3 nrdI Protein NrdI Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8NZA2 6.07e-07 49 34 2 86 3 spyM18_2048 Putative NrdI-like protein Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9T2 7.01e-05 43 34 2 85 3 M6_Spy1696 Putative NrdI-like protein Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XX2 8.16e-05 43 34 2 85 3 SPy_1984 Putative NrdI-like protein Streptococcus pyogenes serotype M1
P0DC73 0.000198 42 32 2 85 3 SPs1706 Putative NrdI-like protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC72 0.000198 42 32 2 85 3 SpyM3_1706 Putative NrdI-like protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q97T03 0.000212 42 30 2 88 1 SP_0158 Putative NrdI-like protein Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DRF4 0.000223 42 30 2 88 4 spr0156 Putative NrdI-like protein Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12850
Feature type CDS
Gene nrdI
Product class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
Location 119764 - 120180 (strand: 1)
Length 417 (nucleotides) / 138 (amino acids)
In genomic island -

Contig

Accession ZDB_690
Length 144397 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1613
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07972 NrdI Flavodoxin like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1780 Nucleotide transport and metabolism (F) F Flavodoxin NrdI, NrdF-interacting activator of class Ib ribonucleotide reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03647 protein involved in ribonucleotide reduction - -

Protein Sequence

MTTQALIYFSTRSETCHRFTEKLGIPATRLPEDGDLTATQPFVLLVPTYGGGHHSGAVPRPVIRFLNRPENRALLRGVIAAGNTNFGRAYAIAGDIIAAKCQVPFLYRFELLGTQADVDNVRRGLHQFWQQQAAEAAC

Flanking regions ( +/- flanking 50bp)

TCCGTCCCGACAAACTTGCCGCCCTCTGAACCGCACACGCCGGAGGCACCATGACCACGCAGGCACTGATTTATTTCTCCACCCGTTCAGAAACCTGTCACCGTTTCACGGAAAAACTGGGGATCCCGGCCACACGGCTGCCGGAAGATGGTGACCTTACCGCCACTCAGCCCTTTGTGCTGCTGGTGCCGACCTACGGCGGCGGCCATCACAGCGGCGCGGTGCCGCGTCCGGTGATCCGCTTTCTCAACCGGCCTGAGAACCGGGCACTGCTGCGTGGTGTGATTGCCGCCGGAAATACCAACTTTGGCCGCGCTTATGCCATCGCCGGTGACATTATCGCCGCCAAATGTCAGGTGCCGTTTTTATACCGTTTTGAACTGCTCGGCACACAGGCGGATGTCGATAACGTCCGCCGCGGCTTACACCAATTCTGGCAGCAGCAGGCCGCTGAGGCCGCCTGCTGAGTGCTGCTTACCTGATTCCGGGATAACACGATGACCACTGAATACACGGA