Homologs in group_2044

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15320 FBDBKF_15320 96.6 Morganella morganii S1 rplS 50S ribosomal protein L19
EHELCC_10925 EHELCC_10925 96.6 Morganella morganii S2 rplS 50S ribosomal protein L19
NLDBIP_11270 NLDBIP_11270 96.6 Morganella morganii S4 rplS 50S ribosomal protein L19
LHKJJB_11130 LHKJJB_11130 96.6 Morganella morganii S3 rplS 50S ribosomal protein L19
HKOGLL_09740 HKOGLL_09740 96.6 Morganella morganii S5 rplS 50S ribosomal protein L19
F4V73_RS12130 F4V73_RS12130 94.9 Morganella psychrotolerans rplS 50S ribosomal protein L19

Distribution of the homologs in the orthogroup group_2044

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2044

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EUW7 5e-81 236 100 0 117 3 rplS Large ribosomal subunit protein bL19 Proteus mirabilis (strain HI4320)
Q3YYN2 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella sonnei (strain Ss046)
P0A7K9 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella flexneri
Q0T174 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella flexneri serotype 5b (strain 8401)
Q32CY2 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella dysenteriae serotype 1 (strain Sd197)
Q31XD9 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella boydii serotype 4 (strain Sb227)
B2TYM8 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUW7 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8B9 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain UTI89 / UPEC)
B1LPB3 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain SMS-3-5 / SECEC)
B6I628 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain SE11)
B7N6J2 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7K6 1.23e-77 227 96 0 115 1 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain K12)
B1IVM7 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7K7 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEN3 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AED6 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O1:K1 / APEC
A8A3B3 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O9:H4 (strain HS)
B1XBS8 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain K12 / DH10B)
C4ZYM4 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M975 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O8 (strain IAI1)
B7MYP6 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O81 (strain ED1a)
B7NSA5 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z225 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7K8 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O157:H7
B7LDJ5 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain 55989 / EAEC)
B7MIU4 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH55 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQ46 1.23e-77 227 96 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AND9 2.08e-77 226 96 0 115 3 rplS Large ribosomal subunit protein bL19 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7N798 2.32e-77 226 94 0 117 3 rplS Large ribosomal subunit protein bL19 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NVK1 3.84e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Sodalis glossinidius (strain morsitans)
A1JK26 6.09e-77 225 94 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A6TCL4 6.37e-77 225 95 0 115 3 rplS Large ribosomal subunit protein bL19 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XVK6 6.37e-77 225 95 0 115 3 rplS Large ribosomal subunit protein bL19 Klebsiella pneumoniae (strain 342)
A7MEG5 6.37e-77 225 95 0 115 3 rplS Large ribosomal subunit protein bL19 Cronobacter sakazakii (strain ATCC BAA-894)
A8GA21 1.36e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Serratia proteamaculans (strain 568)
C5BGF9 1.71e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Edwardsiella ictaluri (strain 93-146)
P0A2A1 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2A2 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella typhi
B4TS53 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella schwarzengrund (strain CVM19633)
B5BE91 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella paratyphi A (strain AKU_12601)
C0PW16 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella paratyphi C (strain RKS4594)
A9MZ47 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFF9 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2B2 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella newport (strain SL254)
B4TE50 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella heidelberg (strain SL476)
B5RD82 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUG1 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella enteritidis PT4 (strain P125109)
B5FS06 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella dublin (strain CT_02021853)
Q57L32 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella choleraesuis (strain SC-B67)
A9MGT8 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F286 2.46e-76 224 94 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella agona (strain SL483)
P36243 3.98e-76 223 94 0 115 3 rplS Large ribosomal subunit protein bL19 Serratia marcescens
B1JJ88 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66E56 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQ65 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis (strain Pestoides F)
Q1CLJ2 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0U2 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBV0 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis
B2K5Z1 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C408 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLQ4 5.54e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DCP8 6.82e-76 223 94 0 115 3 rplS Large ribosomal subunit protein bL19 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A4WDH1 6.89e-76 223 94 0 114 3 rplS Large ribosomal subunit protein bL19 Enterobacter sp. (strain 638)
B2VHI1 2.23e-75 221 93 0 115 3 rplS Large ribosomal subunit protein bL19 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D1U1 4.6e-75 220 93 0 115 3 rplS Large ribosomal subunit protein bL19 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6VLP5 1.65e-72 214 87 0 116 3 rplS Large ribosomal subunit protein bL19 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65VG0 2.77e-72 213 86 0 116 3 rplS Large ribosomal subunit protein bL19 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0BSW1 2.86e-72 213 90 0 114 3 rplS Large ribosomal subunit protein bL19 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ41 2.86e-72 213 90 0 114 3 rplS Large ribosomal subunit protein bL19 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N387 2.86e-72 213 90 0 114 3 rplS Large ribosomal subunit protein bL19 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0UVM9 5.29e-72 213 89 0 114 3 rplS Large ribosomal subunit protein bL19 Histophilus somni (strain 2336)
Q0I1J7 5.29e-72 213 89 0 114 3 rplS Large ribosomal subunit protein bL19 Histophilus somni (strain 129Pt)
P44357 5.97e-72 213 87 0 116 3 rplS Large ribosomal subunit protein bL19 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UG03 5.97e-72 213 87 0 116 3 rplS Large ribosomal subunit protein bL19 Haemophilus influenzae (strain PittGG)
A5UAV4 5.97e-72 213 87 0 116 3 rplS Large ribosomal subunit protein bL19 Haemophilus influenzae (strain PittEE)
Q4QNY9 5.97e-72 213 87 0 116 3 rplS Large ribosomal subunit protein bL19 Haemophilus influenzae (strain 86-028NP)
Q9CLE0 1.66e-71 211 87 0 114 3 rplS Large ribosomal subunit protein bL19 Pasteurella multocida (strain Pm70)
C4K8Z1 4.21e-71 210 86 0 115 3 rplS Large ribosomal subunit protein bL19 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q7VKG2 1.77e-70 209 87 0 114 3 rplS Large ribosomal subunit protein bL19 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MHT3 3.77e-65 196 82 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio vulnificus (strain YJ016)
Q8DC31 3.77e-65 196 82 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio vulnificus (strain CMCP6)
Q6LMW0 1.42e-64 194 83 0 114 3 rplS Large ribosomal subunit protein bL19 Photobacterium profundum (strain SS9)
C3LS54 2.02e-64 194 81 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUF7 2.02e-64 194 81 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F992 2.02e-64 194 81 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q1LTR2 3e-64 193 79 1 116 3 rplS Large ribosomal subunit protein bL19 Baumannia cicadellinicola subsp. Homalodisca coagulata
A7MYU9 4.96e-64 192 80 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio campbellii (strain ATCC BAA-1116)
B5FAE8 2.6e-63 191 80 0 117 3 rplS Large ribosomal subunit protein bL19 Aliivibrio fischeri (strain MJ11)
Q5E7E9 2.6e-63 191 80 0 117 3 rplS Large ribosomal subunit protein bL19 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87LT1 8.69e-63 189 79 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6EGC2 1.39e-62 189 79 0 117 3 rplS Large ribosomal subunit protein bL19 Aliivibrio salmonicida (strain LFI1238)
Q8K9F3 7.73e-62 187 74 0 114 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q3IEC6 2.41e-61 186 79 0 113 3 rplS Large ribosomal subunit protein bL19 Pseudoalteromonas translucida (strain TAC 125)
B7VK26 4.36e-61 185 80 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio atlanticus (strain LGP32)
C4LD24 3.18e-60 183 75 0 115 3 rplS Large ribosomal subunit protein bL19 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q5QUU1 5.55e-60 182 76 0 113 3 rplS Large ribosomal subunit protein bL19 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1S3Z3 2.98e-59 181 76 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8D9I0 3.12e-59 181 74 0 115 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7T2 9.24e-59 179 73 0 115 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57477 1.24e-58 179 73 0 115 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q47WV1 3.11e-58 178 73 0 117 3 rplS Large ribosomal subunit protein bL19 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1RMB5 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sp. (strain W3-18-1)
Q0HSK4 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sp. (strain MR-7)
Q0HGB1 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sp. (strain MR-4)
A0KZM0 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sp. (strain ANA-3)
A4Y4L6 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EH70 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L5P8 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella baltica (strain OS195)
A6WKR9 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella baltica (strain OS185)
A3D1W8 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBP0 3.22e-58 178 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella baltica (strain OS223)
A4SIW0 5.96e-58 177 73 0 115 3 rplS Large ribosomal subunit protein bL19 Aeromonas salmonicida (strain A449)
A0KG26 5.96e-58 177 73 0 115 3 rplS Large ribosomal subunit protein bL19 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q12KJ6 2.45e-57 176 74 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q07Z08 3.33e-57 175 74 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella frigidimarina (strain NCIMB 400)
Q3J8Y1 5.46e-57 175 75 0 113 3 rplS Large ribosomal subunit protein bL19 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A1SZY5 1.28e-56 174 74 1 118 3 rplS Large ribosomal subunit protein bL19 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q15VI6 1.82e-56 174 74 0 113 3 rplS Large ribosomal subunit protein bL19 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A3QBT9 1.04e-55 171 78 0 114 3 rplS Large ribosomal subunit protein bL19 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q493M0 1.05e-55 171 69 0 115 3 rplS Large ribosomal subunit protein bL19 Blochmanniella pennsylvanica (strain BPEN)
B8CQI1 2.03e-55 171 76 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H1E2 6.43e-55 169 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9HXQ2 6.65e-55 169 73 1 115 1 rplS Large ribosomal subunit protein bL19 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02RL5 6.65e-55 169 73 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZM0 6.65e-55 169 73 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas aeruginosa (strain LESB58)
A6V126 6.65e-55 169 73 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas aeruginosa (strain PA7)
B1KI71 7.74e-55 169 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FSF0 8.93e-55 169 76 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sediminis (strain HAW-EB3)
B0TJ78 1.58e-54 169 75 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella halifaxensis (strain HAW-EB4)
C1DSZ9 2.45e-54 168 72 1 116 3 rplS Large ribosomal subunit protein bL19 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1QT51 6.13e-54 167 73 0 111 3 rplS Large ribosomal subunit protein bL19 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5WZE3 9.07e-54 167 70 1 118 3 rplS Large ribosomal subunit protein bL19 Legionella pneumophila (strain Lens)
Q5ZYH7 9.07e-54 167 70 1 118 3 rplS Large ribosomal subunit protein bL19 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHJ8 9.07e-54 167 70 1 118 3 rplS Large ribosomal subunit protein bL19 Legionella pneumophila (strain Corby)
Q5X7Z2 9.07e-54 167 70 1 118 3 rplS Large ribosomal subunit protein bL19 Legionella pneumophila (strain Paris)
C5BR76 1.12e-53 166 72 0 112 3 rplS Large ribosomal subunit protein bL19 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A4XXT4 1.4e-53 166 70 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas mendocina (strain ymp)
Q1I5Z1 3.3e-53 165 70 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas entomophila (strain L48)
Q88MV3 3.84e-53 165 70 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KRI4 3.84e-53 165 70 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas putida (strain GB-1)
A5W8C0 3.84e-53 165 70 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4VIT8 5.96e-53 164 72 1 115 3 rplS Large ribosomal subunit protein bL19 Stutzerimonas stutzeri (strain A1501)
B1JDE2 6.36e-53 164 69 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas putida (strain W619)
B8GN79 7.01e-53 164 73 0 112 3 rplS Large ribosomal subunit protein bL19 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0AA96 8.26e-53 164 68 1 115 3 rplS Large ribosomal subunit protein bL19 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2SL55 9.01e-53 164 71 0 114 3 rplS Large ribosomal subunit protein bL19 Hahella chejuensis (strain KCTC 2396)
A6W1T9 2.26e-52 163 69 1 117 3 rplS Large ribosomal subunit protein bL19 Marinomonas sp. (strain MWYL1)
A1U2Y6 5.38e-52 162 67 0 114 3 rplS Large ribosomal subunit protein bL19 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q21LG1 6.2e-52 162 71 0 113 3 rplS Large ribosomal subunit protein bL19 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5NXM4 7.78e-52 162 67 1 120 3 rplS Large ribosomal subunit protein bL19 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q4ZWY6 1.31e-51 161 68 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas syringae pv. syringae (strain B728a)
Q886U9 1.31e-51 161 68 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48LV7 1.31e-51 161 68 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3KHJ1 1.48e-51 161 69 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas fluorescens (strain Pf0-1)
C3K1G8 1.48e-51 161 69 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas fluorescens (strain SBW25)
Q4KHQ5 1.84e-51 161 69 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3SGC1 1.89e-51 161 69 1 118 3 rplS Large ribosomal subunit protein bL19 Thiobacillus denitrificans (strain ATCC 25259)
A5EXX6 3.86e-51 160 66 0 117 3 rplS Large ribosomal subunit protein bL19 Dichelobacter nodosus (strain VCS1703A)
Q31HX7 4.34e-51 160 69 0 114 3 rplS Large ribosomal subunit protein bL19 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q6F7I2 8e-51 159 69 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1WB49 9.16e-51 159 66 1 118 3 rplS Large ribosomal subunit protein bL19 Acidovorax sp. (strain JS42)
B9ME96 9.16e-51 159 66 1 118 3 rplS Large ribosomal subunit protein bL19 Acidovorax ebreus (strain TPSY)
A1AXD1 1.04e-50 159 67 0 115 3 rplS Large ribosomal subunit protein bL19 Ruthia magnifica subsp. Calyptogena magnifica
B0V8J2 2.45e-50 158 69 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain AYE)
A3M9G4 2.45e-50 158 69 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQ59 2.45e-50 158 69 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain SDF)
B2HZV2 2.45e-50 158 69 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain ACICU)
B7IAS9 2.45e-50 158 69 0 114 1 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain AB0057)
B7GVS1 2.45e-50 158 69 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain AB307-0294)
Q7VQF8 3.28e-50 157 62 0 116 3 rplS Large ribosomal subunit protein bL19 Blochmanniella floridana
Q0BH66 3.96e-50 158 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q47BI8 4.8e-50 157 68 1 115 3 rplS Large ribosomal subunit protein bL19 Dechloromonas aromatica (strain RCB)
Q1BY01 6.27e-50 157 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia orbicola (strain AU 1054)
B1JXU6 6.27e-50 157 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia orbicola (strain MC0-3)
B4EAN3 6.27e-50 157 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K5P8 6.27e-50 157 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia cenocepacia (strain HI2424)
A4JCK0 6.7e-50 157 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1YV60 6.7e-50 157 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia ambifaria (strain MC40-6)
Q1GYT9 6.71e-50 157 68 1 118 3 rplS Large ribosomal subunit protein bL19 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1TND3 8.01e-50 157 65 1 118 3 rplS Large ribosomal subunit protein bL19 Paracidovorax citrulli (strain AAC00-1)
Q8Y0V7 8.74e-50 157 66 1 120 3 rplS Large ribosomal subunit protein bL19 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2U8L3 1.88e-49 156 65 1 120 3 rplS Large ribosomal subunit protein bL19 Ralstonia pickettii (strain 12J)
Q12CW3 2.62e-49 155 64 1 118 3 rplS Large ribosomal subunit protein bL19 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A9ADS8 3.62e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia multivorans (strain ATCC 17616 / 249)
Q82U36 3.69e-49 155 64 1 118 3 rplS Large ribosomal subunit protein bL19 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B2JF32 3.97e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
C1DBG1 4.13e-49 155 67 1 115 3 rplS Large ribosomal subunit protein bL19 Laribacter hongkongensis (strain HLHK9)
Q39ID3 4.66e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2SXZ8 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63S33 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia pseudomallei (strain K96243)
A3NC04 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia pseudomallei (strain 668)
Q3JQ09 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia pseudomallei (strain 1710b)
A3NXU0 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia pseudomallei (strain 1106a)
A1V6J1 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia mallei (strain SAVP1)
Q62M53 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia mallei (strain ATCC 23344)
A2S4N7 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia mallei (strain NCTC 10229)
A3MHS0 4.77e-49 155 65 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia mallei (strain NCTC 10247)
Q13VF1 6.49e-49 155 64 1 120 3 rplS Large ribosomal subunit protein bL19 Paraburkholderia xenovorans (strain LB400)
Q1Q8A7 9.6e-49 155 69 2 117 3 rplS Large ribosomal subunit protein bL19 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQ45 1.02e-48 154 69 2 117 3 rplS Large ribosomal subunit protein bL19 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B2T604 1.26e-48 154 65 1 120 3 rplS Large ribosomal subunit protein bL19 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q0VRE9 1.68e-48 153 67 0 111 3 rplS Large ribosomal subunit protein bL19 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A2SES9 1.7e-48 153 65 1 115 3 rplS Large ribosomal subunit protein bL19 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B5EPC7 2.06e-48 153 67 0 112 3 rplS Large ribosomal subunit protein bL19 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J945 2.06e-48 153 67 0 112 3 rplS Large ribosomal subunit protein bL19 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B1Y0H8 2.11e-48 153 65 1 116 3 rplS Large ribosomal subunit protein bL19 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1VMA0 2.54e-48 153 64 1 118 3 rplS Large ribosomal subunit protein bL19 Polaromonas naphthalenivorans (strain CJ2)
Q60BS0 2.65e-48 153 68 1 113 3 rplS Large ribosomal subunit protein bL19 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5CVW8 3.7e-48 152 67 0 112 3 rplS Large ribosomal subunit protein bL19 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q0AIV2 3.78e-48 153 63 1 118 3 rplS Large ribosomal subunit protein bL19 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1WG50 4.04e-48 153 65 1 118 3 rplS Large ribosomal subunit protein bL19 Verminephrobacter eiseniae (strain EF01-2)
A1K9L2 4.13e-48 153 63 1 120 3 rplS Large ribosomal subunit protein bL19 Azoarcus sp. (strain BH72)
A1WUF2 5.48e-48 152 65 1 116 3 rplS Large ribosomal subunit protein bL19 Halorhodospira halophila (strain DSM 244 / SL1)
Q057I2 5.63e-48 152 62 0 114 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B0TX19 1.31e-47 151 58 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q7NRV7 2.05e-47 151 63 1 118 3 rplS Large ribosomal subunit protein bL19 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2YBJ1 2.16e-47 151 64 1 118 3 rplS Large ribosomal subunit protein bL19 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A4SW76 2.35e-47 151 66 1 120 3 rplS Large ribosomal subunit protein bL19 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q89AE2 3.41e-47 150 57 0 115 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0BKD4 6.2e-47 149 58 0 111 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1N6 6.2e-47 149 58 0 111 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. holarctica (strain LVS)
A7NEB0 6.2e-47 149 58 0 111 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A0Q858 6.84e-47 149 57 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. novicida (strain U112)
B2SFE5 6.84e-47 149 57 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q21YL5 9.94e-47 149 66 1 118 3 rplS Large ribosomal subunit protein bL19 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A4G2T8 1e-46 149 64 1 115 3 rplS Large ribosomal subunit protein bL19 Herminiimonas arsenicoxydans
B1XVN0 1.03e-46 149 65 1 120 3 rplS Large ribosomal subunit protein bL19 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4IWA8 1.07e-46 149 57 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NIC3 1.94e-46 148 56 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JS6 1.94e-46 148 56 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. tularensis (strain FSC 198)
Q67PD7 5.66e-46 147 61 0 117 3 rplS Large ribosomal subunit protein bL19 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q2L2Q1 1.03e-45 147 65 1 120 3 rplS Large ribosomal subunit protein bL19 Bordetella avium (strain 197N)
Q9PH36 1.38e-45 147 64 0 114 3 rplS Large ribosomal subunit protein bL19 Xylella fastidiosa (strain 9a5c)
Q87F53 1.46e-45 147 64 0 114 3 rplS Large ribosomal subunit protein bL19 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U291 1.46e-45 147 64 0 114 3 rplS Large ribosomal subunit protein bL19 Xylella fastidiosa (strain M12)
B2I6A9 1.46e-45 147 64 0 114 3 rplS Large ribosomal subunit protein bL19 Xylella fastidiosa (strain M23)
Q46Y85 4.2e-45 145 68 0 103 3 rplS Large ribosomal subunit protein bL19 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9KA16 5.73e-45 144 63 0 112 3 rplS Large ribosomal subunit protein bL19 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q24UB1 6.34e-45 144 62 0 111 3 rplS Large ribosomal subunit protein bL19 Desulfitobacterium hafniense (strain Y51)
B8FRL1 6.34e-45 144 62 0 111 3 rplS Large ribosomal subunit protein bL19 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q6A7T1 8.09e-45 144 58 0 117 1 rplS Large ribosomal subunit protein bL19 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q1LQD9 8.22e-45 144 70 0 100 3 rplS Large ribosomal subunit protein bL19 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9JVL1 8.47e-45 144 65 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2D0 8.47e-45 144 65 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria meningitidis serogroup C (strain 053442)
A6SVI7 1.43e-44 144 65 1 115 3 rplS Large ribosomal subunit protein bL19 Janthinobacterium sp. (strain Marseille)
Q83E85 3.37e-44 142 61 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBQ8 3.37e-44 142 61 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KEF0 3.37e-44 142 61 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain Dugway 5J108-111)
B6J1N5 3.37e-44 142 61 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain CbuG_Q212)
B6J8J1 3.37e-44 142 61 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain CbuK_Q154)
A1KSJ8 5.16e-44 142 64 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K0K5 5.16e-44 142 64 1 118 1 rplS Large ribosomal subunit protein bL19 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B4RIW2 5.16e-44 142 64 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria gonorrhoeae (strain NCCP11945)
Q5FA60 5.16e-44 142 64 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B3R399 5.4e-44 142 64 1 117 3 rplS Large ribosomal subunit protein bL19 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B6IP95 1.36e-43 141 58 1 119 3 rplS Large ribosomal subunit protein bL19 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q39RP0 1.42e-43 141 62 0 111 3 rplS Large ribosomal subunit protein bL19 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B9M596 3.27e-43 140 62 0 111 3 rplS Large ribosomal subunit protein bL19 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q1GPJ8 3.44e-43 140 61 1 114 3 rplS Large ribosomal subunit protein bL19 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q8D2V2 3.84e-43 140 55 0 112 3 rplS Large ribosomal subunit protein bL19 Wigglesworthia glossinidia brevipalpis
B8FNP1 1.04e-42 139 61 0 111 3 rplS Large ribosomal subunit protein bL19 Desulfatibacillum aliphaticivorans
A9HS58 1.44e-42 139 62 1 116 3 rplS Large ribosomal subunit protein bL19 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q2RJV3 1.73e-42 138 60 0 110 3 rplS Large ribosomal subunit protein bL19 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B2FUB6 1.92e-42 139 61 0 110 3 rplS Large ribosomal subunit protein bL19 Stenotrophomonas maltophilia (strain K279a)
C0ZFN0 2.5e-42 138 58 0 112 3 rplS Large ribosomal subunit protein bL19 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B8IBP2 3.16e-42 138 63 1 114 3 rplS Large ribosomal subunit protein bL19 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q3A2E9 6.27e-42 137 59 0 111 3 rplS Large ribosomal subunit protein bL19 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A9IJN0 6.37e-42 137 62 1 120 3 rplS Large ribosomal subunit protein bL19 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4J664 9.19e-42 136 60 0 110 3 rplS Large ribosomal subunit protein bL19 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B4SPH4 9.29e-42 137 60 0 110 3 rplS Large ribosomal subunit protein bL19 Stenotrophomonas maltophilia (strain R551-3)
Q74FG1 1.06e-41 136 60 0 111 3 rplS Large ribosomal subunit protein bL19 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1HQI4 1.22e-41 136 59 0 112 3 rplS Large ribosomal subunit protein bL19 Lysinibacillus sphaericus (strain C3-41)
A5G7Z3 1.34e-41 136 62 0 111 3 rplS Large ribosomal subunit protein bL19 Geotalea uraniireducens (strain Rf4)
A4XLF0 1.72e-41 136 57 0 114 3 rplS Large ribosomal subunit protein bL19 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q49X27 1.83e-41 135 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2VZV5 1.86e-41 137 58 1 118 3 rplS Large ribosomal subunit protein bL19 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8PBC0 2.47e-41 136 61 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RXD6 2.47e-41 136 61 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas campestris pv. campestris (strain B100)
Q4US85 2.47e-41 136 61 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas campestris pv. campestris (strain 8004)
Q5H389 2.76e-41 135 60 0 112 3 rplS Large ribosomal subunit protein bL19 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P650 2.76e-41 135 60 0 112 3 rplS Large ribosomal subunit protein bL19 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q0KD78 2.95e-41 135 69 0 100 3 rplS Large ribosomal subunit protein bL19 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A7HT09 4.05e-41 135 60 1 116 3 rplS Large ribosomal subunit protein bL19 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B1LZR8 4.35e-41 135 58 1 116 3 rplS Large ribosomal subunit protein bL19 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q5WFN8 4.91e-41 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Shouchella clausii (strain KSM-K16)
Q03RU8 6e-41 134 59 0 112 3 rplS Large ribosomal subunit protein bL19 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q0AWV9 6.37e-41 134 57 0 113 3 rplS Large ribosomal subunit protein bL19 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B2V4E6 6.37e-41 134 53 0 115 3 rplS Large ribosomal subunit protein bL19 Clostridium botulinum (strain Alaska E43 / Type E3)
A5V9Q3 6.8e-41 134 58 1 120 3 rplS Large ribosomal subunit protein bL19 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
P30529 7.03e-41 134 57 0 113 3 rplS Large ribosomal subunit protein bL19 Geobacillus stearothermophilus
B2TJ32 7.26e-41 134 53 0 115 3 rplS Large ribosomal subunit protein bL19 Clostridium botulinum (strain Eklund 17B / Type B)
Q3BVY7 8.06e-41 134 59 0 112 3 rplS Large ribosomal subunit protein bL19 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PMY0 8.42e-41 134 60 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas axonopodis pv. citri (strain 306)
A9W963 9.95e-41 134 60 1 114 3 rplS Large ribosomal subunit protein bL19 Methylorubrum extorquens (strain PA1)
B7KVM8 9.95e-41 134 60 1 114 3 rplS Large ribosomal subunit protein bL19 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B0U8L6 1.17e-40 134 59 1 114 3 rplS Large ribosomal subunit protein bL19 Methylobacterium sp. (strain 4-46)
B1XJH5 1.18e-40 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B1ZAP4 1.18e-40 134 60 1 114 3 rplS Large ribosomal subunit protein bL19 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q9CH65 1.32e-40 133 57 0 111 3 rplS Large ribosomal subunit protein bL19 Lactococcus lactis subsp. lactis (strain IL1403)
Q4JV09 1.46e-40 133 57 0 112 3 rplS Large ribosomal subunit protein bL19 Corynebacterium jeikeium (strain K411)
C6E5I6 1.5e-40 133 58 0 111 3 rplS Large ribosomal subunit protein bL19 Geobacter sp. (strain M21)
B5EBC7 1.5e-40 133 58 0 111 3 rplS Large ribosomal subunit protein bL19 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A3DDH1 1.61e-40 133 60 0 112 3 rplS Large ribosomal subunit protein bL19 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q02ZX9 1.64e-40 133 57 0 111 3 rplS Large ribosomal subunit protein bL19 Lactococcus lactis subsp. cremoris (strain SK11)
A2RLS5 1.64e-40 133 57 0 111 1 rplS Large ribosomal subunit protein bL19 Lactococcus lactis subsp. cremoris (strain MG1363)
A5G0G7 1.67e-40 133 60 1 115 3 rplS Large ribosomal subunit protein bL19 Acidiphilium cryptum (strain JF-5)
Q8EQZ7 1.68e-40 133 59 0 113 3 rplS Large ribosomal subunit protein bL19 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B9MQX0 1.95e-40 133 58 0 110 3 rplS Large ribosomal subunit protein bL19 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q92AM1 2.3e-40 133 58 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
C4XKL7 2.67e-40 132 54 0 111 3 rplS Large ribosomal subunit protein bL19 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q7VZE0 2.81e-40 133 63 1 117 3 rplS Large ribosomal subunit protein bL19 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W9T9 2.81e-40 133 63 1 117 3 rplS Large ribosomal subunit protein bL19 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGW8 2.81e-40 133 63 1 117 3 rplS Large ribosomal subunit protein bL19 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P58167 3.13e-40 133 57 1 116 3 rplS Large ribosomal subunit protein bL19 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A7IIA9 3.33e-40 133 57 1 118 3 rplS Large ribosomal subunit protein bL19 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q833P5 3.64e-40 132 57 0 112 1 rplS Large ribosomal subunit protein bL19 Enterococcus faecalis (strain ATCC 700802 / V583)
A8FD68 3.93e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus pumilus (strain SAFR-032)
C5D8U6 4.72e-40 132 56 0 112 3 rplS Large ribosomal subunit protein bL19 Geobacillus sp. (strain WCH70)
Q3AC74 5.55e-40 132 54 0 111 3 rplS Large ribosomal subunit protein bL19 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A3CNB2 7.02e-40 131 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus sanguinis (strain SK36)
Q65JP5 7.92e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8IKV6 8.19e-40 132 57 1 120 3 rplS Large ribosomal subunit protein bL19 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q89X35 8.58e-40 132 59 1 116 3 rplS Large ribosomal subunit protein bL19 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B9DPI8 8.62e-40 131 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus carnosus (strain TM300)
B0T3B9 1.17e-39 131 54 1 121 3 rplS Large ribosomal subunit protein bL19 Caulobacter sp. (strain K31)
A7GRH0 1.34e-39 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7JWU1 1.4e-39 131 56 0 113 3 rplS Large ribosomal subunit protein bL19 Rippkaea orientalis (strain PCC 8801 / RF-1)
A8AY03 1.43e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P66079 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella suis biovar 1 (strain 1330)
B0CIF8 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSN4 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66078 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFF2 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8P3 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AY9 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella abortus biovar 1 (strain 9-941)
Q2YLP6 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella abortus (strain 2308)
B2S861 1.47e-39 132 56 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella abortus (strain S19)
Q1IXK1 1.47e-39 132 62 0 108 3 rplS Large ribosomal subunit protein bL19 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q038K1 1.48e-39 130 55 0 113 3 rplS Large ribosomal subunit protein bL19 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WET9 1.48e-39 130 55 0 113 3 rplS Large ribosomal subunit protein bL19 Lacticaseibacillus casei (strain BL23)
B3CQN9 1.49e-39 131 50 1 120 3 rplS Large ribosomal subunit protein bL19 Orientia tsutsugamushi (strain Ikeda)
B2IFY8 1.66e-39 132 58 1 117 3 rplS Large ribosomal subunit protein bL19 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A5CCN0 1.66e-39 131 50 1 120 3 rplS Large ribosomal subunit protein bL19 Orientia tsutsugamushi (strain Boryong)
Q8NX05 1.76e-39 130 55 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain MW2)
Q6G9X2 1.76e-39 130 55 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain MSSA476)
Q6GHJ4 1.76e-39 130 55 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain MRSA252)
A6QGE1 1.76e-39 130 55 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain Newman)
Q5HGJ1 1.76e-39 130 55 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain COL)
Q2YXM4 1.76e-39 130 55 1 114 1 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZ42 1.76e-39 130 55 1 114 1 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHJ7 1.76e-39 130 55 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain USA300)
A6UE47 2.25e-39 132 59 1 115 3 rplS Large ribosomal subunit protein bL19 Sinorhizobium medicae (strain WSM419)
Q7V2K1 2.34e-39 132 56 0 114 3 rplS Large ribosomal subunit protein bL19 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P66083 2.44e-39 130 54 1 114 1 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain N315)
P66082 2.44e-39 130 54 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISC6 2.44e-39 130 54 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain JH9)
A6U160 2.44e-39 130 54 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain JH1)
A7X1L2 2.44e-39 130 54 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain Mu3 / ATCC 700698)
C1CR13 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CL28 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain P1031)
C1CEP8 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain JJA)
B2IQ88 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain CGSP14)
Q97QC6 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZJV6 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICA7 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain Hungary19A-6)
C1C7S2 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain 70585)
B5E529 2.5e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae serotype 19F (strain G54)
B2G816 2.58e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKN2 2.58e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Limosilactobacillus reuteri (strain DSM 20016)
Q8UBZ5 2.62e-39 132 57 1 117 3 rplS Large ribosomal subunit protein bL19 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8DTP5 2.64e-39 130 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A7Z4M4 2.7e-39 130 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q0BRH2 2.8e-39 130 59 1 116 3 rplS Large ribosomal subunit protein bL19 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B5YK97 3.03e-39 130 58 0 112 3 rplS Large ribosomal subunit protein bL19 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q8CWQ9 3.18e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04K32 3.18e-39 130 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
O31742 3.28e-39 130 58 0 112 1 rplS Large ribosomal subunit protein bL19 Bacillus subtilis (strain 168)
A6WXG3 3.44e-39 130 55 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A0Q0X9 3.95e-39 130 56 0 115 3 rplS Large ribosomal subunit protein bL19 Clostridium novyi (strain NT)
Q92L39 4.05e-39 132 59 1 115 3 rplS Large ribosomal subunit protein bL19 Rhizobium meliloti (strain 1021)
O34031 4.18e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus thermophilus
Q03KD6 4.18e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M427 4.18e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZH5 4.18e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus thermophilus (strain CNRZ 1066)
A9VT78 4.33e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus mycoides (strain KBAB4)
C0M695 4.37e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus equi subsp. equi (strain 4047)
A0AJP5 4.73e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q11CQ9 6.32e-39 131 55 1 120 3 rplS Large ribosomal subunit protein bL19 Chelativorans sp. (strain BNC1)
C3MAF7 6.93e-39 131 60 1 115 3 rplS Large ribosomal subunit protein bL19 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
C0MHA6 7.3e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2A0 7.3e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q6HEX5 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636I6 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain ZK / E33L)
Q819W6 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IVC9 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain Q1)
B7HLH3 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain AH187)
B7HDW3 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain B4264)
C1EP64 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain 03BB102)
B7IUJ9 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain G9842)
Q732N0 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJS6 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain AH820)
Q81WJ6 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus anthracis
A0RHL3 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus thuringiensis (strain Al Hakam)
C3L787 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5P1 7.32e-39 129 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus anthracis (strain A0248)
Q2N9R0 7.44e-39 129 63 1 114 3 rplS Large ribosomal subunit protein bL19 Erythrobacter litoralis (strain HTCC2594)
A4VT80 7.55e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus suis (strain 05ZYH33)
A4VZG2 7.55e-39 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus suis (strain 98HAH33)
O53083 7.99e-39 129 57 0 112 1 rplS Large ribosomal subunit protein bL19 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDW6 7.99e-39 129 57 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria monocytogenes serotype 4a (strain HCC23)
Q71YM9 7.99e-39 129 57 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria monocytogenes serotype 4b (strain F2365)
C1KW86 7.99e-39 129 57 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria monocytogenes serotype 4b (strain CLIP80459)
B1YIM3 8.94e-39 129 60 0 110 3 rplS Large ribosomal subunit protein bL19 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q8CSU9 9.37e-39 129 56 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPV0 9.37e-39 129 56 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q38XQ6 9.71e-39 129 57 0 112 3 rplS Large ribosomal subunit protein bL19 Latilactobacillus sakei subsp. sakei (strain 23K)
Q97I93 1.04e-38 129 55 0 112 3 rplS Large ribosomal subunit protein bL19 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B8I7T6 1.07e-38 129 54 0 115 3 rplS Large ribosomal subunit protein bL19 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q31C59 1.09e-38 129 53 0 115 3 rplS Large ribosomal subunit protein bL19 Prochlorococcus marinus (strain MIT 9312)
A1AMZ8 1.09e-38 129 55 0 111 3 rplS Large ribosomal subunit protein bL19 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B5XKM2 1.16e-38 128 56 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M49 (strain NZ131)
Q2RV56 1.43e-38 130 55 1 119 3 rplS Large ribosomal subunit protein bL19 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P0DE15 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48UG3 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RFE9 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J7J0 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JMM0 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCP4 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66086 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XD07 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE14 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66084 1.55e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M1
B4RCC6 1.56e-38 129 56 1 116 3 rplS Large ribosomal subunit protein bL19 Phenylobacterium zucineum (strain HLK1)
Q1JHR3 1.59e-38 128 55 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M2 (strain MGAS10270)
B8EN97 1.64e-38 129 56 1 119 3 rplS Large ribosomal subunit protein bL19 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q4L5U3 1.81e-38 128 55 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus haemolyticus (strain JCSC1435)
C0R442 2.03e-38 128 51 1 116 3 rplS Large ribosomal subunit protein bL19 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73GD6 2.03e-38 128 51 1 116 3 rplS Large ribosomal subunit protein bL19 Wolbachia pipientis wMel
Q6AJE6 2.19e-38 128 54 0 113 3 rplS Large ribosomal subunit protein bL19 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q6KHL6 2.25e-38 128 53 0 109 3 rplS Large ribosomal subunit protein bL19 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q1MAK2 2.4e-38 130 58 1 115 3 rplS Large ribosomal subunit protein bL19 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q5GT54 2.73e-38 128 51 1 120 3 rplS Large ribosomal subunit protein bL19 Wolbachia sp. subsp. Brugia malayi (strain TRS)
B3PR19 2.83e-38 129 58 1 115 3 rplS Large ribosomal subunit protein bL19 Rhizobium etli (strain CIAT 652)
Q2K379 2.93e-38 129 58 1 115 3 rplS Large ribosomal subunit protein bL19 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1WU89 3.31e-38 127 55 0 113 3 rplS Large ribosomal subunit protein bL19 Ligilactobacillus salivarius (strain UCC118)
C4L604 3.43e-38 127 60 0 109 3 rplS Large ribosomal subunit protein bL19 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B1I2N2 3.45e-38 127 58 0 111 3 rplS Large ribosomal subunit protein bL19 Desulforudis audaxviator (strain MP104C)
B2GFY5 3.88e-38 127 51 0 111 3 rplS Large ribosomal subunit protein bL19 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q6G1S0 3.96e-38 128 56 1 116 3 rplS Large ribosomal subunit protein bL19 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B2JA71 4.01e-38 127 58 0 112 3 rplS Large ribosomal subunit protein bL19 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B9L044 4.11e-38 127 54 1 114 3 rplS Large ribosomal subunit protein bL19 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
P36239 4.65e-38 127 58 0 112 3 rplS Large ribosomal subunit protein bL19 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DJC4 5.57e-38 127 56 0 113 3 rplS Large ribosomal subunit protein bL19 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q6AEA5 5.84e-38 127 55 0 111 3 rplS Large ribosomal subunit protein bL19 Leifsonia xyli subsp. xyli (strain CTCB07)
Q3SNV5 6.96e-38 127 57 1 116 3 rplS Large ribosomal subunit protein bL19 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1QHI6 7.52e-38 127 57 1 116 3 rplS Large ribosomal subunit protein bL19 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q1RH65 8.34e-38 127 56 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia bellii (strain RML369-C)
A8GUW0 8.34e-38 127 56 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia bellii (strain OSU 85-389)
A9IZA0 8.42e-38 127 56 1 116 3 rplS Large ribosomal subunit protein bL19 Bartonella tribocorum (strain CIP 105476 / IBS 506)
B2GD23 9.24e-38 126 54 0 112 3 rplS Large ribosomal subunit protein bL19 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B2A2P3 1.07e-37 126 57 0 109 3 rplS Large ribosomal subunit protein bL19 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q2JU45 1.08e-37 126 57 0 114 3 rplS Large ribosomal subunit protein bL19 Synechococcus sp. (strain JA-3-3Ab)
Q2LVU4 1.23e-37 126 55 0 110 3 rplS Large ribosomal subunit protein bL19 Syntrophus aciditrophicus (strain SB)
Q47S63 1.38e-37 125 54 0 113 3 rplS Large ribosomal subunit protein bL19 Thermobifida fusca (strain YX)
B1MZW8 1.39e-37 126 55 0 112 3 rplS Large ribosomal subunit protein bL19 Leuconostoc citreum (strain KM20)
B3QXJ5 1.64e-37 125 52 1 114 3 rplS Large ribosomal subunit protein bL19 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q28UF3 1.88e-37 126 57 2 114 3 rplS Large ribosomal subunit protein bL19 Jannaschia sp. (strain CCS1)
Q8FP56 1.89e-37 125 54 0 111 3 rplS Large ribosomal subunit protein bL19 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A6LSN2 2.05e-37 125 50 0 115 3 rplS Large ribosomal subunit protein bL19 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q313K0 2.37e-37 125 57 0 109 3 rplS Large ribosomal subunit protein bL19 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q2JHW3 2.4e-37 125 59 0 108 3 rplS Large ribosomal subunit protein bL19 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q049S3 2.42e-37 125 54 0 113 3 rplS Large ribosomal subunit protein bL19 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9L7 2.42e-37 125 54 0 113 3 rplS Large ribosomal subunit protein bL19 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
B9JUC8 2.71e-37 127 56 1 115 3 rplS Large ribosomal subunit protein bL19 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A8GM74 2.78e-37 125 54 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia akari (strain Hartford)
P58168 2.82e-37 127 56 1 115 3 rplS Large ribosomal subunit protein bL19 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q4UNA7 2.94e-37 125 54 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B0TH69 2.96e-37 125 58 0 113 3 rplS Large ribosomal subunit protein bL19 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B6JAQ7 3.86e-37 125 52 1 120 3 rplS Large ribosomal subunit protein bL19 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q03YK1 4.27e-37 124 54 0 112 3 rplS Large ribosomal subunit protein bL19 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A8GQT3 5.53e-37 125 55 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia rickettsii (strain Sheila Smith)
B0BW79 5.53e-37 125 55 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia rickettsii (strain Iowa)
Q5YS45 5.6e-37 124 54 0 111 3 rplS Large ribosomal subunit protein bL19 Nocardia farcinica (strain IFM 10152)
A5E907 5.92e-37 124 56 1 116 3 rplS Large ribosomal subunit protein bL19 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A8YVT1 6.35e-37 124 53 0 112 3 rplS Large ribosomal subunit protein bL19 Lactobacillus helveticus (strain DPC 4571)
Q5FJK8 6.35e-37 124 53 0 112 3 rplS Large ribosomal subunit protein bL19 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q88WJ1 6.36e-37 124 55 0 112 3 rplS Large ribosomal subunit protein bL19 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A4YK97 6.37e-37 124 56 1 116 3 rplS Large ribosomal subunit protein bL19 Bradyrhizobium sp. (strain ORS 278)
B0JNQ1 7.13e-37 124 54 0 113 3 rplS Large ribosomal subunit protein bL19 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B9DRQ9 7.4e-37 124 54 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q8E121 7.4e-37 124 54 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E6H6 7.4e-37 124 54 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus agalactiae serotype III (strain NEM316)
Q3K2D0 7.4e-37 124 54 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B1MDI1 7.6e-37 124 54 0 111 3 rplS Large ribosomal subunit protein bL19 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q03FW2 8.7e-37 124 56 0 112 3 rplS Large ribosomal subunit protein bL19 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A8F0L7 9.05e-37 124 54 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia massiliae (strain Mtu5)
B8HT34 9.68e-37 124 53 0 112 3 rplS Large ribosomal subunit protein bL19 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B2UM93 1e-36 124 56 0 113 3 rplS Large ribosomal subunit protein bL19 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01875
Feature type CDS
Gene rplS
Product 50S ribosomal protein L19
Location 439674 - 440027 (strand: 1)
Length 354 (nucleotides) / 117 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2044
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01245 Ribosomal protein L19

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0335 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L19

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02884 large subunit ribosomal protein L19 Ribosome -

Protein Sequence

MSNIIKQIEQEQMKQDVPSFRPGDNVEVKVWVVEGSKKRLQAFEGVVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVVDSITVKRRGAVRKAKLYYLRERSGKAARIKERLNAK

Flanking regions ( +/- flanking 50bp)

CTGACACAAAGTGTCATTAATATCAGTTTACCTAGGGTAAGAGAGTTATTATGAGCAATATTATTAAACAAATCGAACAAGAACAAATGAAGCAAGATGTACCTTCATTTCGTCCAGGCGATAATGTAGAAGTTAAGGTATGGGTCGTTGAAGGTTCTAAAAAACGTCTGCAGGCATTCGAGGGCGTGGTTATCGCTATTCGTAACCGCGGTCTGCACTCTGCATTTACTGTTCGTAAAATTTCTAATGGCGAAGGTGTTGAGCGTGTATTCCAAACTCACTCCCCAGTCGTAGATAGCATCACAGTTAAACGTCGTGGTGCGGTTCGTAAAGCTAAACTGTACTACCTGCGTGAGCGTTCAGGTAAGGCTGCACGTATTAAAGAGCGTCTTAACGCTAAATAATACGCTTTCGCACATCCGAAAGTTATGGTTAAAAGGCCAGCATCAGCTGG