Homologs in group_2084

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15320 FBDBKF_15320 100.0 Morganella morganii S1 rplS 50S ribosomal protein L19
EHELCC_10925 EHELCC_10925 100.0 Morganella morganii S2 rplS 50S ribosomal protein L19
LHKJJB_11130 LHKJJB_11130 100.0 Morganella morganii S3 rplS 50S ribosomal protein L19
HKOGLL_09740 HKOGLL_09740 100.0 Morganella morganii S5 rplS 50S ribosomal protein L19
F4V73_RS12130 F4V73_RS12130 95.7 Morganella psychrotolerans rplS 50S ribosomal protein L19
PMI_RS01875 PMI_RS01875 96.6 Proteus mirabilis HI4320 rplS 50S ribosomal protein L19

Distribution of the homologs in the orthogroup group_2084

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2084

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EUW7 6.26e-79 230 96 0 117 3 rplS Large ribosomal subunit protein bL19 Proteus mirabilis (strain HI4320)
Q3YYN2 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella sonnei (strain Ss046)
P0A7K9 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella flexneri
Q0T174 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella flexneri serotype 5b (strain 8401)
Q32CY2 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella dysenteriae serotype 1 (strain Sd197)
Q31XD9 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella boydii serotype 4 (strain Sb227)
B2TYM8 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUW7 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8B9 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain UTI89 / UPEC)
B1LPB3 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain SMS-3-5 / SECEC)
B6I628 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain SE11)
B7N6J2 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7K6 8.33e-79 230 98 0 115 1 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain K12)
B1IVM7 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7K7 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEN3 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AED6 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O1:K1 / APEC
A8A3B3 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O9:H4 (strain HS)
B1XBS8 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain K12 / DH10B)
C4ZYM4 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M975 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O8 (strain IAI1)
B7MYP6 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O81 (strain ED1a)
B7NSA5 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z225 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7K8 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O157:H7
B7LDJ5 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli (strain 55989 / EAEC)
B7MIU4 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH55 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQ46 8.33e-79 230 98 0 115 3 rplS Large ribosomal subunit protein bL19 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7N798 1.08e-78 229 95 0 117 3 rplS Large ribosomal subunit protein bL19 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8AND9 2.21e-78 229 97 0 115 3 rplS Large ribosomal subunit protein bL19 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TCL4 7.17e-78 228 96 0 115 3 rplS Large ribosomal subunit protein bL19 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XVK6 7.17e-78 228 96 0 115 3 rplS Large ribosomal subunit protein bL19 Klebsiella pneumoniae (strain 342)
A7MEG5 7.17e-78 228 96 0 115 3 rplS Large ribosomal subunit protein bL19 Cronobacter sakazakii (strain ATCC BAA-894)
P0A2A1 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2A2 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella typhi
B4TS53 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella schwarzengrund (strain CVM19633)
B5BE91 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella paratyphi A (strain AKU_12601)
C0PW16 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella paratyphi C (strain RKS4594)
A9MZ47 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFF9 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2B2 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella newport (strain SL254)
B4TE50 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella heidelberg (strain SL476)
B5RD82 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUG1 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella enteritidis PT4 (strain P125109)
B5FS06 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella dublin (strain CT_02021853)
Q57L32 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella choleraesuis (strain SC-B67)
A9MGT8 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F286 2.59e-77 226 95 0 115 3 rplS Large ribosomal subunit protein bL19 Salmonella agona (strain SL483)
Q2NVK1 2.02e-76 224 93 0 115 3 rplS Large ribosomal subunit protein bL19 Sodalis glossinidius (strain morsitans)
A1JK26 2.86e-76 224 93 0 115 3 rplS Large ribosomal subunit protein bL19 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5BGF9 3.3e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Edwardsiella ictaluri (strain 93-146)
C6DCP8 3.42e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8GA21 4.3e-76 223 93 0 115 3 rplS Large ribosomal subunit protein bL19 Serratia proteamaculans (strain 568)
P36243 8.58e-76 222 93 0 115 3 rplS Large ribosomal subunit protein bL19 Serratia marcescens
A4WDH1 1.13e-75 222 93 0 114 3 rplS Large ribosomal subunit protein bL19 Enterobacter sp. (strain 638)
B1JJ88 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66E56 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQ65 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis (strain Pestoides F)
Q1CLJ2 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0U2 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBV0 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis
B2K5Z1 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C408 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLQ4 4.41e-75 220 92 0 114 3 rplS Large ribosomal subunit protein bL19 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D1U1 1.44e-74 219 91 0 115 3 rplS Large ribosomal subunit protein bL19 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VHI1 1.59e-74 219 92 0 114 3 rplS Large ribosomal subunit protein bL19 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q65VG0 1.92e-73 216 87 0 116 3 rplS Large ribosomal subunit protein bL19 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44357 8.93e-73 214 88 0 116 3 rplS Large ribosomal subunit protein bL19 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UG03 8.93e-73 214 88 0 116 3 rplS Large ribosomal subunit protein bL19 Haemophilus influenzae (strain PittGG)
A5UAV4 8.93e-73 214 88 0 116 3 rplS Large ribosomal subunit protein bL19 Haemophilus influenzae (strain PittEE)
Q4QNY9 8.93e-73 214 88 0 116 3 rplS Large ribosomal subunit protein bL19 Haemophilus influenzae (strain 86-028NP)
A6VLP5 1.04e-72 214 87 0 116 3 rplS Large ribosomal subunit protein bL19 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0BSW1 1.18e-72 214 90 0 114 3 rplS Large ribosomal subunit protein bL19 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ41 1.18e-72 214 90 0 114 3 rplS Large ribosomal subunit protein bL19 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N387 1.18e-72 214 90 0 114 3 rplS Large ribosomal subunit protein bL19 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9CLE0 5.12e-72 213 88 0 114 3 rplS Large ribosomal subunit protein bL19 Pasteurella multocida (strain Pm70)
B0UVM9 2.71e-71 211 87 0 114 3 rplS Large ribosomal subunit protein bL19 Histophilus somni (strain 2336)
Q0I1J7 2.71e-71 211 87 0 114 3 rplS Large ribosomal subunit protein bL19 Histophilus somni (strain 129Pt)
C4K8Z1 1.32e-70 209 85 0 115 3 rplS Large ribosomal subunit protein bL19 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q7VKG2 1.93e-70 209 86 0 114 3 rplS Large ribosomal subunit protein bL19 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MHT3 4.28e-67 200 84 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio vulnificus (strain YJ016)
Q8DC31 4.28e-67 200 84 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio vulnificus (strain CMCP6)
C3LS54 2.95e-66 198 83 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUF7 2.95e-66 198 83 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F992 2.95e-66 198 83 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MYU9 6.73e-66 197 82 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio campbellii (strain ATCC BAA-1116)
B5FAE8 3.41e-65 196 82 0 117 3 rplS Large ribosomal subunit protein bL19 Aliivibrio fischeri (strain MJ11)
Q5E7E9 3.41e-65 196 82 0 117 3 rplS Large ribosomal subunit protein bL19 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6LMW0 7.43e-65 195 83 0 114 3 rplS Large ribosomal subunit protein bL19 Photobacterium profundum (strain SS9)
Q87LT1 1.67e-64 194 82 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6EGC2 1.54e-63 191 80 0 117 3 rplS Large ribosomal subunit protein bL19 Aliivibrio salmonicida (strain LFI1238)
Q1LTR2 4.82e-63 190 76 1 116 3 rplS Large ribosomal subunit protein bL19 Baumannia cicadellinicola subsp. Homalodisca coagulata
B7VK26 1.01e-62 189 82 0 117 3 rplS Large ribosomal subunit protein bL19 Vibrio atlanticus (strain LGP32)
Q3IEC6 1.27e-62 189 81 0 113 3 rplS Large ribosomal subunit protein bL19 Pseudoalteromonas translucida (strain TAC 125)
C4LD24 3.96e-62 188 78 0 115 3 rplS Large ribosomal subunit protein bL19 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8K9F3 7.56e-62 187 73 0 114 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q5QUU1 1.14e-61 187 79 0 113 3 rplS Large ribosomal subunit protein bL19 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1S3Z3 4.04e-61 185 78 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A1RMB5 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sp. (strain W3-18-1)
Q0HSK4 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sp. (strain MR-7)
Q0HGB1 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sp. (strain MR-4)
A0KZM0 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sp. (strain ANA-3)
A4Y4L6 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EH70 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L5P8 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella baltica (strain OS195)
A6WKR9 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella baltica (strain OS185)
A3D1W8 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBP0 4.82e-60 182 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella baltica (strain OS223)
A4SIW0 9.43e-60 182 76 0 115 3 rplS Large ribosomal subunit protein bL19 Aeromonas salmonicida (strain A449)
A0KG26 9.43e-60 182 76 0 115 3 rplS Large ribosomal subunit protein bL19 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q47WV1 2.44e-59 181 75 0 117 3 rplS Large ribosomal subunit protein bL19 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q12KJ6 3.83e-59 180 76 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8D9I0 4.29e-59 180 73 0 115 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q07Z08 5.33e-59 180 76 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella frigidimarina (strain NCIMB 400)
B8D7T2 9.87e-59 179 73 0 115 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57477 1.31e-58 179 73 0 115 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q15VI6 1.32e-57 176 75 0 113 3 rplS Large ribosomal subunit protein bL19 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3J8Y1 1.36e-57 176 76 0 113 3 rplS Large ribosomal subunit protein bL19 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A3QBT9 1.46e-57 176 81 0 114 3 rplS Large ribosomal subunit protein bL19 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q493M0 2.15e-57 176 71 0 115 3 rplS Large ribosomal subunit protein bL19 Blochmanniella pennsylvanica (strain BPEN)
B8CQI1 2.7e-57 176 78 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella piezotolerans (strain WP3 / JCM 13877)
A1SZY5 4.61e-57 175 74 1 118 3 rplS Large ribosomal subunit protein bL19 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B1KI71 7.74e-57 174 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FSF0 9.02e-57 174 78 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella sediminis (strain HAW-EB3)
A8H1E2 9.43e-57 174 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TJ78 1.99e-56 173 77 0 117 3 rplS Large ribosomal subunit protein bL19 Shewanella halifaxensis (strain HAW-EB4)
Q9HXQ2 2.17e-55 171 73 1 115 1 rplS Large ribosomal subunit protein bL19 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02RL5 2.17e-55 171 73 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZM0 2.17e-55 171 73 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas aeruginosa (strain LESB58)
A6V126 2.17e-55 171 73 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas aeruginosa (strain PA7)
Q1QT51 4.04e-55 170 74 0 113 3 rplS Large ribosomal subunit protein bL19 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0AA96 9.96e-55 169 71 1 115 3 rplS Large ribosomal subunit protein bL19 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4XXT4 1.08e-54 169 72 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas mendocina (strain ymp)
B8GN79 1.09e-54 169 74 0 114 3 rplS Large ribosomal subunit protein bL19 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C1DSZ9 1.65e-54 169 72 1 116 3 rplS Large ribosomal subunit protein bL19 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
C5BR76 2.19e-54 168 73 0 112 3 rplS Large ribosomal subunit protein bL19 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q5WZE3 2.46e-54 168 70 1 118 3 rplS Large ribosomal subunit protein bL19 Legionella pneumophila (strain Lens)
Q5ZYH7 2.46e-54 168 70 1 118 3 rplS Large ribosomal subunit protein bL19 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHJ8 2.46e-54 168 70 1 118 3 rplS Large ribosomal subunit protein bL19 Legionella pneumophila (strain Corby)
Q5X7Z2 2.46e-54 168 70 1 118 3 rplS Large ribosomal subunit protein bL19 Legionella pneumophila (strain Paris)
A4VIT8 3.44e-54 168 73 1 115 3 rplS Large ribosomal subunit protein bL19 Stutzerimonas stutzeri (strain A1501)
Q1I5Z1 3.97e-54 167 71 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas entomophila (strain L48)
Q88MV3 5.28e-54 167 71 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KRI4 5.28e-54 167 71 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas putida (strain GB-1)
A5W8C0 5.28e-54 167 71 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1JDE2 7.67e-54 167 70 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas putida (strain W619)
Q5NXM4 9.09e-54 167 70 1 120 3 rplS Large ribosomal subunit protein bL19 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q2SL55 1.38e-53 166 71 0 114 3 rplS Large ribosomal subunit protein bL19 Hahella chejuensis (strain KCTC 2396)
A1U2Y6 1.59e-53 166 70 0 114 3 rplS Large ribosomal subunit protein bL19 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3SGC1 2.88e-53 166 72 1 118 3 rplS Large ribosomal subunit protein bL19 Thiobacillus denitrificans (strain ATCC 25259)
Q21LG1 3.75e-53 165 73 0 113 3 rplS Large ribosomal subunit protein bL19 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A6W1T9 9.18e-53 164 69 1 117 3 rplS Large ribosomal subunit protein bL19 Marinomonas sp. (strain MWYL1)
A1WB49 1.24e-52 164 69 1 118 3 rplS Large ribosomal subunit protein bL19 Acidovorax sp. (strain JS42)
B9ME96 1.24e-52 164 69 1 118 3 rplS Large ribosomal subunit protein bL19 Acidovorax ebreus (strain TPSY)
Q4ZWY6 1.31e-52 164 69 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas syringae pv. syringae (strain B728a)
Q886U9 1.31e-52 164 69 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48LV7 1.31e-52 164 69 1 116 3 rplS Large ribosomal subunit protein bL19 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3KHJ1 1.45e-52 164 70 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas fluorescens (strain Pf0-1)
C3K1G8 1.45e-52 164 70 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas fluorescens (strain SBW25)
Q4KHQ5 1.76e-52 163 70 1 115 3 rplS Large ribosomal subunit protein bL19 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5EXX6 3.35e-52 163 68 0 117 3 rplS Large ribosomal subunit protein bL19 Dichelobacter nodosus (strain VCS1703A)
Q31HX7 4.11e-52 162 70 0 114 3 rplS Large ribosomal subunit protein bL19 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q6F7I2 7.02e-52 162 71 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q47BI8 7.71e-52 162 71 1 115 3 rplS Large ribosomal subunit protein bL19 Dechloromonas aromatica (strain RCB)
Q7VQF8 8.63e-52 162 62 0 116 3 rplS Large ribosomal subunit protein bL19 Blochmanniella floridana
A1TND3 1.02e-51 162 67 1 118 3 rplS Large ribosomal subunit protein bL19 Paracidovorax citrulli (strain AAC00-1)
Q0BH66 1.07e-51 162 68 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1BY01 1.45e-51 162 68 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia orbicola (strain AU 1054)
B1JXU6 1.45e-51 162 68 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia orbicola (strain MC0-3)
B4EAN3 1.45e-51 162 68 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K5P8 1.45e-51 162 68 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia cenocepacia (strain HI2424)
Q1GYT9 1.48e-51 161 71 1 118 3 rplS Large ribosomal subunit protein bL19 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A4JCK0 1.76e-51 161 68 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1YV60 1.76e-51 161 68 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia ambifaria (strain MC40-6)
B0V8J2 2.3e-51 161 70 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain AYE)
A3M9G4 2.3e-51 161 70 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQ59 2.3e-51 161 70 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain SDF)
B2HZV2 2.3e-51 161 70 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain ACICU)
B7IAS9 2.3e-51 161 70 0 114 1 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain AB0057)
B7GVS1 2.3e-51 161 70 0 114 3 rplS Large ribosomal subunit protein bL19 Acinetobacter baumannii (strain AB307-0294)
Q12CW3 3.57e-51 160 66 1 118 3 rplS Large ribosomal subunit protein bL19 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1AXD1 4.62e-51 160 67 0 115 3 rplS Large ribosomal subunit protein bL19 Ruthia magnifica subsp. Calyptogena magnifica
C1DBG1 5.76e-51 160 70 1 115 3 rplS Large ribosomal subunit protein bL19 Laribacter hongkongensis (strain HLHK9)
Q82U36 5.8e-51 160 66 1 118 3 rplS Large ribosomal subunit protein bL19 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8Y0V7 6.59e-51 160 67 1 120 3 rplS Large ribosomal subunit protein bL19 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A9ADS8 1.24e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia multivorans (strain ATCC 17616 / 249)
Q2SXZ8 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63S33 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia pseudomallei (strain K96243)
A3NC04 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia pseudomallei (strain 668)
Q3JQ09 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia pseudomallei (strain 1710b)
A3NXU0 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia pseudomallei (strain 1106a)
A1V6J1 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia mallei (strain SAVP1)
Q62M53 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia mallei (strain ATCC 23344)
A2S4N7 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia mallei (strain NCTC 10229)
A3MHS0 1.28e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia mallei (strain NCTC 10247)
Q39ID3 1.35e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B2JF32 1.55e-50 159 67 1 120 3 rplS Large ribosomal subunit protein bL19 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B2U8L3 1.77e-50 159 66 1 120 3 rplS Large ribosomal subunit protein bL19 Ralstonia pickettii (strain 12J)
Q13VF1 2.15e-50 159 66 1 120 3 rplS Large ribosomal subunit protein bL19 Paraburkholderia xenovorans (strain LB400)
A1VMA0 2.98e-50 158 66 1 118 3 rplS Large ribosomal subunit protein bL19 Polaromonas naphthalenivorans (strain CJ2)
A2SES9 3.25e-50 158 67 1 115 3 rplS Large ribosomal subunit protein bL19 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q60BS0 3.81e-50 157 70 1 113 3 rplS Large ribosomal subunit protein bL19 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B1Y0H8 3.83e-50 157 68 1 116 3 rplS Large ribosomal subunit protein bL19 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B2T604 4.14e-50 158 67 1 120 3 rplS Large ribosomal subunit protein bL19 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1K9L2 5.28e-50 157 65 1 120 3 rplS Large ribosomal subunit protein bL19 Azoarcus sp. (strain BH72)
Q0AIV2 6.64e-50 157 66 1 118 3 rplS Large ribosomal subunit protein bL19 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1WG50 6.65e-50 157 67 1 118 3 rplS Large ribosomal subunit protein bL19 Verminephrobacter eiseniae (strain EF01-2)
Q4FQ45 1.15e-49 157 70 2 117 3 rplS Large ribosomal subunit protein bL19 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8A7 1.24e-49 157 70 2 117 3 rplS Large ribosomal subunit protein bL19 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B5EPC7 1.73e-49 155 68 0 112 3 rplS Large ribosomal subunit protein bL19 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J945 1.73e-49 155 68 0 112 3 rplS Large ribosomal subunit protein bL19 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q0VRE9 1.89e-49 156 68 0 111 3 rplS Large ribosomal subunit protein bL19 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1WUF2 3.43e-49 155 67 1 116 3 rplS Large ribosomal subunit protein bL19 Halorhodospira halophila (strain DSM 244 / SL1)
Q7NRV7 4.18e-49 155 66 1 118 3 rplS Large ribosomal subunit protein bL19 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2YBJ1 5.32e-49 155 66 1 118 3 rplS Large ribosomal subunit protein bL19 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A5CVW8 1.49e-48 154 67 0 112 3 rplS Large ribosomal subunit protein bL19 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A4G2T8 1.65e-48 154 66 1 115 3 rplS Large ribosomal subunit protein bL19 Herminiimonas arsenicoxydans
Q21YL5 1.88e-48 154 68 1 118 3 rplS Large ribosomal subunit protein bL19 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A4SW76 2.69e-48 153 67 1 120 3 rplS Large ribosomal subunit protein bL19 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q057I2 1.09e-47 151 60 0 114 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B1XVN0 1.19e-47 152 66 1 120 3 rplS Large ribosomal subunit protein bL19 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q89AE2 1.26e-47 151 57 0 115 3 rplS Large ribosomal subunit protein bL19 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2L2Q1 1.36e-47 151 67 1 120 3 rplS Large ribosomal subunit protein bL19 Bordetella avium (strain 197N)
B0TX19 1.94e-47 150 58 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0BKD4 4.46e-47 150 58 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1N6 4.46e-47 150 58 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. holarctica (strain LVS)
A7NEB0 4.46e-47 150 58 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A0Q858 6e-47 149 58 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. novicida (strain U112)
B2SFE5 6e-47 149 58 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q67PD7 7.63e-47 149 62 0 117 3 rplS Large ribosomal subunit protein bL19 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A4IWA8 1.06e-46 149 58 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q9PH36 1.4e-46 149 64 0 114 3 rplS Large ribosomal subunit protein bL19 Xylella fastidiosa (strain 9a5c)
Q46Y85 1.47e-46 149 70 0 103 3 rplS Large ribosomal subunit protein bL19 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9JVL1 1.47e-46 149 67 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2D0 1.47e-46 149 67 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria meningitidis serogroup C (strain 053442)
Q87F53 1.54e-46 149 64 0 114 3 rplS Large ribosomal subunit protein bL19 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U291 1.54e-46 149 64 0 114 3 rplS Large ribosomal subunit protein bL19 Xylella fastidiosa (strain M12)
B2I6A9 1.54e-46 149 64 0 114 3 rplS Large ribosomal subunit protein bL19 Xylella fastidiosa (strain M23)
Q5NIC3 1.96e-46 148 57 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JS6 1.96e-46 148 57 0 113 3 rplS Large ribosomal subunit protein bL19 Francisella tularensis subsp. tularensis (strain FSC 198)
Q1LQD9 2.45e-46 148 72 0 100 3 rplS Large ribosomal subunit protein bL19 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A6SVI7 2.86e-46 148 67 1 115 3 rplS Large ribosomal subunit protein bL19 Janthinobacterium sp. (strain Marseille)
Q83E85 4.76e-46 147 64 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBQ8 4.76e-46 147 64 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KEF0 4.76e-46 147 64 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain Dugway 5J108-111)
B6J1N5 4.76e-46 147 64 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain CbuG_Q212)
B6J8J1 4.76e-46 147 64 1 115 3 rplS Large ribosomal subunit protein bL19 Coxiella burnetii (strain CbuK_Q154)
Q9KA16 6.41e-46 147 64 0 112 3 rplS Large ribosomal subunit protein bL19 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1KSJ8 9.9e-46 146 66 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K0K5 9.9e-46 146 66 1 118 1 rplS Large ribosomal subunit protein bL19 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B4RIW2 9.9e-46 146 66 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria gonorrhoeae (strain NCCP11945)
Q5FA60 9.9e-46 146 66 1 118 3 rplS Large ribosomal subunit protein bL19 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q24UB1 1.1e-45 146 63 0 111 3 rplS Large ribosomal subunit protein bL19 Desulfitobacterium hafniense (strain Y51)
B8FRL1 1.1e-45 146 63 0 111 3 rplS Large ribosomal subunit protein bL19 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q39RP0 1.72e-45 146 64 0 111 3 rplS Large ribosomal subunit protein bL19 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B6IP95 2.35e-45 146 61 1 119 3 rplS Large ribosomal subunit protein bL19 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q6A7T1 4.63e-45 145 58 0 117 1 rplS Large ribosomal subunit protein bL19 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B3R399 4.7e-45 145 64 1 117 3 rplS Large ribosomal subunit protein bL19 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B9M596 2.05e-44 143 63 0 111 3 rplS Large ribosomal subunit protein bL19 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q2RJV3 2.78e-44 142 63 0 110 3 rplS Large ribosomal subunit protein bL19 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B8IBP2 3.92e-44 143 65 1 114 3 rplS Large ribosomal subunit protein bL19 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
C0ZFN0 4.74e-44 142 60 0 112 3 rplS Large ribosomal subunit protein bL19 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A9HS58 6.08e-44 142 63 1 116 3 rplS Large ribosomal subunit protein bL19 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q3A2E9 6.58e-44 142 62 0 111 3 rplS Large ribosomal subunit protein bL19 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8FNP1 7.61e-44 141 62 0 111 3 rplS Large ribosomal subunit protein bL19 Desulfatibacillum aliphaticivorans
A9IJN0 1.1e-43 141 65 1 120 3 rplS Large ribosomal subunit protein bL19 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q1GPJ8 1.3e-43 141 61 1 114 3 rplS Large ribosomal subunit protein bL19 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A4J664 1.74e-43 140 62 0 110 3 rplS Large ribosomal subunit protein bL19 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B2FUB6 2.4e-43 141 62 0 110 3 rplS Large ribosomal subunit protein bL19 Stenotrophomonas maltophilia (strain K279a)
Q2VZV5 2.42e-43 141 61 1 118 3 rplS Large ribosomal subunit protein bL19 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q74FG1 6.96e-43 139 61 0 111 3 rplS Large ribosomal subunit protein bL19 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1LZR8 8.48e-43 139 61 1 116 3 rplS Large ribosomal subunit protein bL19 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q8D2V2 8.92e-43 139 53 0 112 3 rplS Large ribosomal subunit protein bL19 Wigglesworthia glossinidia brevipalpis
A5G7Z3 9.88e-43 139 63 0 111 3 rplS Large ribosomal subunit protein bL19 Geotalea uraniireducens (strain Rf4)
B4SPH4 1.1e-42 139 61 0 110 3 rplS Large ribosomal subunit protein bL19 Stenotrophomonas maltophilia (strain R551-3)
B1HQI4 1.22e-42 139 60 0 112 3 rplS Large ribosomal subunit protein bL19 Lysinibacillus sphaericus (strain C3-41)
A5V9Q3 1.23e-42 139 60 1 120 3 rplS Large ribosomal subunit protein bL19 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q0KD78 1.24e-42 139 71 0 100 3 rplS Large ribosomal subunit protein bL19 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B0U8L6 1.57e-42 139 62 1 114 3 rplS Large ribosomal subunit protein bL19 Methylobacterium sp. (strain 4-46)
A4XLF0 1.6e-42 139 57 0 114 3 rplS Large ribosomal subunit protein bL19 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B1ZAP4 1.61e-42 139 63 1 114 3 rplS Large ribosomal subunit protein bL19 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W963 1.64e-42 139 63 1 114 3 rplS Large ribosomal subunit protein bL19 Methylorubrum extorquens (strain PA1)
B7KVM8 1.64e-42 139 63 1 114 3 rplS Large ribosomal subunit protein bL19 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q8PBC0 2.11e-42 139 62 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RXD6 2.11e-42 139 62 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas campestris pv. campestris (strain B100)
Q4US85 2.11e-42 139 62 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas campestris pv. campestris (strain 8004)
Q49X27 2.46e-42 138 59 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5H389 2.77e-42 138 62 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P650 2.77e-42 138 62 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A7HT09 3.65e-42 138 61 1 116 3 rplS Large ribosomal subunit protein bL19 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A7IIA9 4.58e-42 138 60 1 118 3 rplS Large ribosomal subunit protein bL19 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q03RU8 5.22e-42 137 60 0 112 3 rplS Large ribosomal subunit protein bL19 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q7VZE0 5.53e-42 137 65 1 117 3 rplS Large ribosomal subunit protein bL19 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W9T9 5.53e-42 137 65 1 117 3 rplS Large ribosomal subunit protein bL19 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGW8 5.53e-42 137 65 1 117 3 rplS Large ribosomal subunit protein bL19 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5WFN8 6e-42 137 59 0 112 3 rplS Large ribosomal subunit protein bL19 Shouchella clausii (strain KSM-K16)
C4XKL7 6.32e-42 137 56 0 111 3 rplS Large ribosomal subunit protein bL19 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q0AWV9 7.13e-42 137 58 0 113 3 rplS Large ribosomal subunit protein bL19 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P58167 7.26e-42 137 60 1 116 3 rplS Large ribosomal subunit protein bL19 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q833P5 7.8e-42 136 59 0 112 1 rplS Large ribosomal subunit protein bL19 Enterococcus faecalis (strain ATCC 700802 / V583)
Q3BVY7 8.19e-42 137 61 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PMY0 8.19e-42 137 61 0 111 3 rplS Large ribosomal subunit protein bL19 Xanthomonas axonopodis pv. citri (strain 306)
P30529 8.31e-42 136 58 0 113 3 rplS Large ribosomal subunit protein bL19 Geobacillus stearothermophilus
Q9CH65 9.01e-42 136 58 0 111 3 rplS Large ribosomal subunit protein bL19 Lactococcus lactis subsp. lactis (strain IL1403)
C6E5I6 9.85e-42 136 59 0 111 3 rplS Large ribosomal subunit protein bL19 Geobacter sp. (strain M21)
B5EBC7 9.85e-42 136 59 0 111 3 rplS Large ribosomal subunit protein bL19 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B1XJH5 1.12e-41 136 59 0 112 3 rplS Large ribosomal subunit protein bL19 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A3CNB2 1.16e-41 136 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus sanguinis (strain SK36)
A8IKV6 1.19e-41 136 60 1 120 3 rplS Large ribosomal subunit protein bL19 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q89X35 1.22e-41 136 62 1 116 3 rplS Large ribosomal subunit protein bL19 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q02ZX9 1.29e-41 136 58 0 111 3 rplS Large ribosomal subunit protein bL19 Lactococcus lactis subsp. cremoris (strain SK11)
A2RLS5 1.29e-41 136 58 0 111 1 rplS Large ribosomal subunit protein bL19 Lactococcus lactis subsp. cremoris (strain MG1363)
Q4JV09 1.3e-41 136 58 0 112 3 rplS Large ribosomal subunit protein bL19 Corynebacterium jeikeium (strain K411)
Q3AC74 1.63e-41 135 57 0 111 3 rplS Large ribosomal subunit protein bL19 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8EQZ7 1.88e-41 135 60 0 113 3 rplS Large ribosomal subunit protein bL19 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B9MQX0 1.89e-41 136 59 0 110 3 rplS Large ribosomal subunit protein bL19 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A8AY03 2.04e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B2IFY8 2.14e-41 136 61 1 117 3 rplS Large ribosomal subunit protein bL19 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q92AM1 2.42e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P66079 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella suis biovar 1 (strain 1330)
B0CIF8 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSN4 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66078 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFF2 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8P3 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57AY9 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella abortus biovar 1 (strain 9-941)
Q2YLP6 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella abortus (strain 2308)
B2S861 2.54e-41 136 59 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella abortus (strain S19)
B0T3B9 2.79e-41 135 57 1 121 3 rplS Large ribosomal subunit protein bL19 Caulobacter sp. (strain K31)
A5CCN0 2.96e-41 135 52 1 120 3 rplS Large ribosomal subunit protein bL19 Orientia tsutsugamushi (strain Boryong)
B3CQN9 3.2e-41 135 52 1 120 3 rplS Large ribosomal subunit protein bL19 Orientia tsutsugamushi (strain Ikeda)
C1CR13 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CL28 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain P1031)
C1CEP8 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain JJA)
B2IQ88 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain CGSP14)
Q97QC6 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZJV6 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICA7 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain Hungary19A-6)
C1C7S2 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain 70585)
B5E529 3.5e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae serotype 19F (strain G54)
Q8CWQ9 3.82e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04K32 3.82e-41 135 59 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8FD68 4.26e-41 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus pumilus (strain SAFR-032)
Q8DTP5 4.5e-41 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8UBZ5 4.75e-41 137 59 1 117 3 rplS Large ribosomal subunit protein bL19 Agrobacterium fabrum (strain C58 / ATCC 33970)
A6UE47 4.84e-41 136 61 1 115 3 rplS Large ribosomal subunit protein bL19 Sinorhizobium medicae (strain WSM419)
C5D8U6 5.29e-41 134 57 0 112 3 rplS Large ribosomal subunit protein bL19 Geobacillus sp. (strain WCH70)
A3DDH1 5.8e-41 134 60 0 112 3 rplS Large ribosomal subunit protein bL19 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A6WXG3 6.1e-41 135 58 1 118 3 rplS Large ribosomal subunit protein bL19 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q92L39 7.09e-41 136 61 1 115 3 rplS Large ribosomal subunit protein bL19 Rhizobium meliloti (strain 1021)
O34031 7.12e-41 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus thermophilus
Q03KD6 7.12e-41 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M427 7.12e-41 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZH5 7.12e-41 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus thermophilus (strain CNRZ 1066)
Q7V2K1 7.67e-41 135 57 0 114 3 rplS Large ribosomal subunit protein bL19 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
B9DPI8 8.56e-41 134 58 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus carnosus (strain TM300)
Q0BRH2 8.74e-41 134 61 1 116 3 rplS Large ribosomal subunit protein bL19 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
C0M695 9.68e-41 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus equi subsp. equi (strain 4047)
Q65JP5 1.09e-40 134 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A1AMZ8 1.13e-40 134 58 0 111 3 rplS Large ribosomal subunit protein bL19 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
C3MAF7 1.34e-40 135 62 1 115 3 rplS Large ribosomal subunit protein bL19 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A4VT80 1.42e-40 133 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus suis (strain 05ZYH33)
A4VZG2 1.42e-40 133 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus suis (strain 98HAH33)
C0MHA6 1.53e-40 133 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2A0 1.53e-40 133 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q11CQ9 1.56e-40 135 57 1 120 3 rplS Large ribosomal subunit protein bL19 Chelativorans sp. (strain BNC1)
A7GRH0 1.57e-40 133 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B5XKM2 1.83e-40 133 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M49 (strain NZ131)
B4RCC6 2.37e-40 133 59 1 116 3 rplS Large ribosomal subunit protein bL19 Phenylobacterium zucineum (strain HLK1)
B8EN97 2.39e-40 134 58 1 119 3 rplS Large ribosomal subunit protein bL19 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B5YK97 2.42e-40 133 58 0 112 3 rplS Large ribosomal subunit protein bL19 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q8NX05 2.45e-40 133 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain MW2)
Q6G9X2 2.45e-40 133 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain MSSA476)
Q6GHJ4 2.45e-40 133 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain MRSA252)
A6QGE1 2.45e-40 133 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain Newman)
Q5HGJ1 2.45e-40 133 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain COL)
Q2YXM4 2.45e-40 133 57 1 114 1 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZ42 2.45e-40 133 57 1 114 1 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHJ7 2.45e-40 133 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain USA300)
Q1JHR3 2.51e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M2 (strain MGAS10270)
B2V4E6 2.7e-40 132 53 0 115 3 rplS Large ribosomal subunit protein bL19 Clostridium botulinum (strain Alaska E43 / Type E3)
P0DE15 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48UG3 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RFE9 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J7J0 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JMM0 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCP4 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66086 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XD07 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE14 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66084 2.8e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus pyogenes serotype M1
Q31C59 2.84e-40 133 55 0 115 3 rplS Large ribosomal subunit protein bL19 Prochlorococcus marinus (strain MIT 9312)
A0Q0X9 2.88e-40 132 57 0 115 3 rplS Large ribosomal subunit protein bL19 Clostridium novyi (strain NT)
A7Z4M4 2.96e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B2G816 3.12e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKN2 3.12e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Limosilactobacillus reuteri (strain DSM 20016)
P66083 3.33e-40 132 56 1 114 1 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain N315)
P66082 3.33e-40 132 56 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISC6 3.33e-40 132 56 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain JH9)
A6U160 3.33e-40 132 56 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain JH1)
A7X1L2 3.33e-40 132 56 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus aureus (strain Mu3 / ATCC 700698)
O31742 3.33e-40 132 58 0 112 1 rplS Large ribosomal subunit protein bL19 Bacillus subtilis (strain 168)
B2TJ32 3.59e-40 132 53 0 115 3 rplS Large ribosomal subunit protein bL19 Clostridium botulinum (strain Eklund 17B / Type B)
Q1MAK2 3.65e-40 134 60 1 115 3 rplS Large ribosomal subunit protein bL19 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K379 4.31e-40 134 60 1 115 3 rplS Large ribosomal subunit protein bL19 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PR19 4.31e-40 134 60 1 115 3 rplS Large ribosomal subunit protein bL19 Rhizobium etli (strain CIAT 652)
Q1IXK1 4.43e-40 133 63 0 108 3 rplS Large ribosomal subunit protein bL19 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q2RV56 4.86e-40 134 57 1 119 3 rplS Large ribosomal subunit protein bL19 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A0AJP5 4.96e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A9VT78 5.12e-40 132 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus mycoides (strain KBAB4)
B2GFY5 6.01e-40 132 54 0 111 3 rplS Large ribosomal subunit protein bL19 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A5G0G7 6.28e-40 132 59 1 115 3 rplS Large ribosomal subunit protein bL19 Acidiphilium cryptum (strain JF-5)
Q6G1S0 6.66e-40 132 58 1 116 3 rplS Large ribosomal subunit protein bL19 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
O53083 7.35e-40 131 58 0 112 1 rplS Large ribosomal subunit protein bL19 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDW6 7.35e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria monocytogenes serotype 4a (strain HCC23)
Q71YM9 7.35e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria monocytogenes serotype 4b (strain F2365)
C1KW86 7.35e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Listeria monocytogenes serotype 4b (strain CLIP80459)
B7JWU1 8.43e-40 131 56 0 113 3 rplS Large ribosomal subunit protein bL19 Rippkaea orientalis (strain PCC 8801 / RF-1)
Q3SNV5 9.16e-40 132 60 1 116 3 rplS Large ribosomal subunit protein bL19 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q8CSU9 9.41e-40 131 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPV0 9.41e-40 131 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6HEX5 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636I6 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain ZK / E33L)
Q819W6 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IVC9 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain Q1)
B7HLH3 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain AH187)
B7HDW3 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain B4264)
C1EP64 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain 03BB102)
B7IUJ9 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain G9842)
Q732N0 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJS6 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus cereus (strain AH820)
Q81WJ6 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus anthracis
A0RHL3 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus thuringiensis (strain Al Hakam)
C3L787 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5P1 9.77e-40 131 58 0 112 3 rplS Large ribosomal subunit protein bL19 Bacillus anthracis (strain A0248)
Q1QHI6 9.89e-40 131 60 1 116 3 rplS Large ribosomal subunit protein bL19 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q97I93 1.16e-39 131 56 0 112 3 rplS Large ribosomal subunit protein bL19 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1YIM3 1.35e-39 131 61 0 110 3 rplS Large ribosomal subunit protein bL19 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A9IZA0 1.67e-39 132 58 1 116 3 rplS Large ribosomal subunit protein bL19 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q1RH65 1.88e-39 131 57 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia bellii (strain RML369-C)
A8GUW0 1.88e-39 131 57 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia bellii (strain OSU 85-389)
Q4L5U3 1.9e-39 130 57 1 114 3 rplS Large ribosomal subunit protein bL19 Staphylococcus haemolyticus (strain JCSC1435)
B1I2N2 2.07e-39 130 60 0 111 3 rplS Large ribosomal subunit protein bL19 Desulforudis audaxviator (strain MP104C)
Q2LVU4 2.22e-39 130 58 0 110 3 rplS Large ribosomal subunit protein bL19 Syntrophus aciditrophicus (strain SB)
Q6AJE6 2.74e-39 130 55 0 113 3 rplS Large ribosomal subunit protein bL19 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q47S63 2.98e-39 130 57 0 113 3 rplS Large ribosomal subunit protein bL19 Thermobifida fusca (strain YX)
B2JA71 3.65e-39 130 58 0 112 3 rplS Large ribosomal subunit protein bL19 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B8I7T6 3.78e-39 130 54 0 115 3 rplS Large ribosomal subunit protein bL19 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
C4L604 3.89e-39 130 61 0 109 3 rplS Large ribosomal subunit protein bL19 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q6AEA5 4.32e-39 129 57 0 111 3 rplS Large ribosomal subunit protein bL19 Leifsonia xyli subsp. xyli (strain CTCB07)
P36239 4.33e-39 130 58 0 112 3 rplS Large ribosomal subunit protein bL19 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q049S3 5.09e-39 129 57 0 113 3 rplS Large ribosomal subunit protein bL19 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9L7 5.09e-39 129 57 0 113 3 rplS Large ribosomal subunit protein bL19 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
B9JUC8 5.14e-39 131 59 1 115 3 rplS Large ribosomal subunit protein bL19 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B6JAQ7 5.74e-39 130 56 1 116 3 rplS Large ribosomal subunit protein bL19 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
P58168 6.29e-39 131 59 1 115 3 rplS Large ribosomal subunit protein bL19 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q4UNA7 6.48e-39 130 56 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8GM74 6.99e-39 130 56 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia akari (strain Hartford)
B9L044 7.38e-39 129 56 1 114 3 rplS Large ribosomal subunit protein bL19 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q38XQ6 7.71e-39 129 57 0 112 3 rplS Large ribosomal subunit protein bL19 Latilactobacillus sakei subsp. sakei (strain 23K)
A5E907 7.88e-39 129 58 1 116 3 rplS Large ribosomal subunit protein bL19 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q038K1 8.33e-39 129 54 0 113 3 rplS Large ribosomal subunit protein bL19 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WET9 8.33e-39 129 54 0 113 3 rplS Large ribosomal subunit protein bL19 Lacticaseibacillus casei (strain BL23)
B3QXJ5 8.46e-39 129 54 1 114 3 rplS Large ribosomal subunit protein bL19 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A4YK97 9.99e-39 129 58 1 116 3 rplS Large ribosomal subunit protein bL19 Bradyrhizobium sp. (strain ORS 278)
B2GD23 1.03e-38 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
C0R442 1.04e-38 129 52 1 116 3 rplS Large ribosomal subunit protein bL19 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73GD6 1.04e-38 129 52 1 116 3 rplS Large ribosomal subunit protein bL19 Wolbachia pipientis wMel
Q2N9R0 1.08e-38 129 63 1 114 3 rplS Large ribosomal subunit protein bL19 Erythrobacter litoralis (strain HTCC2594)
A8YVT1 1.08e-38 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Lactobacillus helveticus (strain DPC 4571)
Q5FJK8 1.08e-38 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A6LSN2 1.17e-38 129 51 0 115 3 rplS Large ribosomal subunit protein bL19 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A8GQT3 1.18e-38 129 56 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia rickettsii (strain Sheila Smith)
B0BW79 1.18e-38 129 56 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia rickettsii (strain Iowa)
B8HT34 1.19e-38 129 56 0 112 3 rplS Large ribosomal subunit protein bL19 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q8FP56 1.3e-38 128 56 0 111 3 rplS Large ribosomal subunit protein bL19 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B1MZW8 1.36e-38 128 57 0 112 3 rplS Large ribosomal subunit protein bL19 Leuconostoc citreum (strain KM20)
Q5GT54 1.43e-38 129 52 1 120 3 rplS Large ribosomal subunit protein bL19 Wolbachia sp. subsp. Brugia malayi (strain TRS)
B9DRQ9 1.49e-38 128 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q8E121 1.49e-38 128 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E6H6 1.49e-38 128 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus agalactiae serotype III (strain NEM316)
Q3K2D0 1.49e-38 128 57 0 112 3 rplS Large ribosomal subunit protein bL19 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A8F0L7 1.5e-38 129 56 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia massiliae (strain Mtu5)
Q1WU89 1.66e-38 128 55 0 113 3 rplS Large ribosomal subunit protein bL19 Ligilactobacillus salivarius (strain UCC118)
Q28UF3 1.75e-38 128 59 2 114 3 rplS Large ribosomal subunit protein bL19 Jannaschia sp. (strain CCS1)
A8LMB3 2.65e-38 128 57 2 119 3 rplS Large ribosomal subunit protein bL19 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q9ZE36 2.8e-38 128 55 3 126 3 rplS Large ribosomal subunit protein bL19 Rickettsia prowazekii (strain Madrid E)
Q92JB5 2.96e-38 128 56 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8EXH8 3.06e-38 128 55 2 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia canadensis (strain McKiel)
Q5YS45 3.22e-38 127 55 0 111 3 rplS Large ribosomal subunit protein bL19 Nocardia farcinica (strain IFM 10152)
Q03YK1 3.57e-38 127 56 0 112 3 rplS Large ribosomal subunit protein bL19 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q0AKL3 3.88e-38 127 54 1 120 3 rplS Large ribosomal subunit protein bL19 Maricaulis maris (strain MCS10)
Q8DJC4 4.83e-38 127 56 0 113 3 rplS Large ribosomal subunit protein bL19 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A0ZZY0 5.03e-38 127 58 1 115 3 rplS Large ribosomal subunit protein bL19 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
B2UM93 5.72e-38 127 57 0 113 3 rplS Large ribosomal subunit protein bL19 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q6FYH5 5.74e-38 128 57 1 116 3 rplS Large ribosomal subunit protein bL19 Bartonella quintana (strain Toulouse)
B1MDI1 5.88e-38 127 55 0 111 3 rplS Large ribosomal subunit protein bL19 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q68XY0 5.96e-38 127 56 3 125 3 rplS Large ribosomal subunit protein bL19 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q74IQ7 6.09e-38 127 55 0 113 3 rplS Large ribosomal subunit protein bL19 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_11270
Feature type CDS
Gene rplS
Product 50S ribosomal protein L19
Location 12599 - 12952 (strand: -1)
Length 354 (nucleotides) / 117 (amino acids)
In genomic island -

Contig

Accession ZDB_526
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2084
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01245 Ribosomal protein L19

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0335 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L19

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02884 large subunit ribosomal protein L19 Ribosome -

Protein Sequence

MSNIIKQLEQEQMKQDVPSFRPGDTVEVKVWVVEGSKKRLQAFEGVVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVVDSISVKRRGAVRRAKLYYLRERSGKAARIKERLNAK

Flanking regions ( +/- flanking 50bp)

CTGCGGGATATCTTTTGAAATATCAGTTTACCTAGGGTAAGAGATTTATTATGAGCAACATTATTAAACAACTTGAACAAGAGCAGATGAAACAAGACGTACCTTCATTCCGTCCGGGTGACACCGTGGAAGTTAAGGTATGGGTCGTTGAAGGTTCTAAAAAACGTCTGCAGGCATTCGAGGGCGTGGTTATCGCTATCCGTAACCGCGGTCTGCACTCTGCATTCACTGTTCGCAAGATTTCTAACGGCGAAGGTGTTGAGCGTGTATTCCAGACTCACTCACCTGTTGTTGACAGCATCAGCGTTAAACGCCGTGGTGCCGTTCGTCGTGCTAAACTGTACTACCTGCGTGAGCGTTCAGGTAAGGCAGCTCGTATTAAAGAGCGTTTGAACGCAAAATAATGCGCAAGCATCCGATATGATAATAAAAGGCCAGCCTCGTGCTGGCCTTT