Homologs in group_1845

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13795 FBDBKF_13795 66.1 Morganella morganii S1 ycaP DUF421 domain-containing protein
EHELCC_11465 EHELCC_11465 66.1 Morganella morganii S2 ycaP DUF421 domain-containing protein
NLDBIP_11810 NLDBIP_11810 66.1 Morganella morganii S4 ycaP DUF421 domain-containing protein
LHKJJB_11670 LHKJJB_11670 66.1 Morganella morganii S3 ycaP DUF421 domain-containing protein
HKOGLL_10280 HKOGLL_10280 66.1 Morganella morganii S5 ycaP DUF421 domain-containing protein
F4V73_RS12665 F4V73_RS12665 67.4 Morganella psychrotolerans - DUF421 domain-containing protein

Distribution of the homologs in the orthogroup group_1845

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1845

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O31533 3.38e-30 114 33 3 220 1 yetF UPF0702 transmembrane protein YetF Bacillus subtilis (strain 168)
P96697 5.84e-22 93 30 5 222 3 ydfS UPF0702 transmembrane protein YdfS Bacillus subtilis (strain 168)
O32050 7.51e-17 79 26 3 220 3 yrbG UPF0702 transmembrane protein YrbG Bacillus subtilis (strain 168)
P49853 4.08e-06 49 20 4 197 3 ykjA UPF0702 transmembrane protein YkjA Bacillus subtilis (strain 168)
P75839 0.000143 45 20 2 147 3 ycaP UPF0702 transmembrane protein YcaP Escherichia coli (strain K12)
P96696 0.000293 44 25 3 134 3 ydfR UPF0702 transmembrane protein YdfR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01220
Feature type CDS
Gene -
Product DUF421 domain-containing protein
Location 299567 - 300241 (strand: 1)
Length 675 (nucleotides) / 224 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1845
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04239 YetF C-terminal domain
PF20730 YetF N-terminal transmembrane domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2323 Function unknown (S) S Uncharacterized membrane protein YcaP, DUF421 family

Protein Sequence

MEYYLLVVIKFIIGFTIILAHMNISGKTQLSQLTPIDFIGNFVLGGIMGGVIYTDAIPLYQYVIVFLIGVFFISFLNYISKKFNFFRAVAIGNPIPIIKKGRFIMENITEKKNKIDILNITSRLHAQGIHSFQEVNYAQIEPDGQITVVCDGAKMPSIIIMKDGVIRTSELEQIERDENWLNEEMKKQHIDNPEDVFLAEFWDGKVNFILQDGKIKHDFIPTAE

Flanking regions ( +/- flanking 50bp)

TTTATGCTTTATAATTACAGTGTGAATCGTTTTGCAAAGGTGCTTAAGAAATGGAATATTATCTGCTTGTGGTTATCAAGTTTATTATTGGTTTTACAATAATTTTGGCTCATATGAATATTTCAGGGAAGACACAACTCTCTCAACTAACTCCCATTGATTTTATTGGTAATTTTGTTTTAGGGGGGATTATGGGAGGGGTTATTTACACAGATGCAATCCCGCTTTACCAATATGTTATTGTCTTTTTGATAGGTGTATTTTTTATTTCTTTTCTCAATTATATCAGTAAAAAATTTAATTTTTTCCGAGCAGTAGCGATAGGTAATCCGATCCCGATTATTAAAAAGGGAAGATTTATTATGGAAAACATTACTGAGAAGAAAAATAAGATTGATATTCTTAATATCACTTCTAGGTTACATGCCCAAGGAATTCATTCTTTTCAAGAAGTTAATTATGCTCAAATTGAACCTGATGGACAAATAACGGTGGTGTGTGATGGTGCTAAAATGCCCTCTATCATTATTATGAAAGATGGTGTTATCCGAACTTCTGAACTTGAGCAGATAGAACGAGATGAAAATTGGTTAAACGAAGAGATGAAAAAACAACATATAGATAACCCAGAAGATGTTTTTTTAGCCGAATTTTGGGATGGTAAAGTCAATTTCATTTTGCAAGACGGTAAGATCAAACACGATTTCATTCCGACTGCTGAGTAGCAATATCCTGTGAAAGAATAAAAGCAACGATTAATACTATCTCAAGAGTC