Homologs in group_1867

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13955 FBDBKF_13955 57.0 Morganella morganii S1 gloB hydroxyacylglutathione hydrolase
EHELCC_11625 EHELCC_11625 57.0 Morganella morganii S2 gloB hydroxyacylglutathione hydrolase
NLDBIP_11970 NLDBIP_11970 57.0 Morganella morganii S4 gloB hydroxyacylglutathione hydrolase
LHKJJB_11830 LHKJJB_11830 57.0 Morganella morganii S3 gloB hydroxyacylglutathione hydrolase
HKOGLL_10440 HKOGLL_10440 57.0 Morganella morganii S5 gloB hydroxyacylglutathione hydrolase
F4V73_RS12810 F4V73_RS12810 57.4 Morganella psychrotolerans gloB hydroxyacylglutathione hydrolase

Distribution of the homologs in the orthogroup group_1867

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1867

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A6T510 1.34e-104 306 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y1G4 1.93e-104 305 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Klebsiella pneumoniae (strain 342)
B1JR44 5.05e-104 305 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667M5 5.05e-104 305 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KAD1 5.05e-104 305 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFK5 5.05e-104 305 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N809 6.56e-104 304 58 1 251 3 gloB Hydroxyacylglutathione hydrolase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1CFI4 2.46e-103 303 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WHW5 2.46e-103 303 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis
Q1CAJ7 2.46e-103 303 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis bv. Antiqua (strain Antiqua)
A4W6V2 3.2e-103 302 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Enterobacter sp. (strain 638)
A1JKA9 3.36e-102 300 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4TL56 4.98e-102 300 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis (strain Pestoides F)
C5BEP2 1.11e-100 296 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Edwardsiella ictaluri (strain 93-146)
A8GA75 7.29e-100 294 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Serratia proteamaculans (strain 568)
C4K7Z9 4.66e-99 292 52 1 251 3 gloB Hydroxyacylglutathione hydrolase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q6D1V5 2.94e-97 287 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1LHM1 4.86e-97 287 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKW6 4.86e-97 287 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A7ZWF4 5.13e-97 287 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O9:H4 (strain HS)
P0AC84 5.3e-97 286 55 0 251 1 gloB Hydroxyacylglutathione hydrolase GloB Escherichia coli (strain K12)
B1XD76 5.3e-97 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain K12 / DH10B)
C4ZRU9 5.3e-97 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z0I6 5.3e-97 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AC85 5.3e-97 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O157:H7
Q3Z5F1 1e-96 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella sonnei (strain Ss046)
B2U350 1e-96 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7ZHU8 1e-96 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7M211 1.02e-96 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O8 (strain IAI1)
B7LHB8 1.02e-96 286 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain 55989 / EAEC)
B6HZS5 1.82e-96 285 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain SE11)
B1IPU6 2.2e-96 285 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TLC5 2.27e-96 285 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UJA8 2.27e-96 285 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A1A7Q3 4e-96 285 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O1:K1 / APEC
B7MBI8 4e-96 285 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q1RFX9 4.09e-96 285 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain UTI89 / UPEC)
B7LW87 4.72e-96 284 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7N874 5.38e-96 284 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FKY7 5.62e-96 284 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MQ21 1.12e-95 283 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O81 (strain ED1a)
Q83MC1 1.62e-95 283 56 2 253 3 gloB Hydroxyacylglutathione hydrolase Shigella flexneri
Q0T802 1.62e-95 283 56 2 253 3 gloB Hydroxyacylglutathione hydrolase Shigella flexneri serotype 5b (strain 8401)
Q325T4 1.62e-95 283 56 2 253 3 gloB Hydroxyacylglutathione hydrolase Shigella boydii serotype 4 (strain Sb227)
C6DC67 1.83e-95 283 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VHJ7 2.8e-95 282 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q32JQ1 3.48e-95 282 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella dysenteriae serotype 1 (strain Sd197)
Q8Z983 1.61e-94 280 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella typhi
Q2NVG1 4.13e-92 274 49 1 251 3 gloB Hydroxyacylglutathione hydrolase Sodalis glossinidius (strain morsitans)
A8AKR2 1.33e-91 273 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8ZRM2 5.81e-91 271 54 0 251 1 gloB Hydroxyacylglutathione hydrolase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BDW7 7.46e-91 271 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi A (strain AKU_12601)
Q5PFD6 7.46e-91 271 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TYG8 9.18e-91 271 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella schwarzengrund (strain CVM19633)
A9MZ21 9.18e-91 271 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SV37 9.18e-91 271 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella newport (strain SL254)
B4TK83 9.18e-91 271 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella heidelberg (strain SL476)
Q57SZ8 9.18e-91 271 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella choleraesuis (strain SC-B67)
B5F8X0 9.18e-91 271 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella agona (strain SL483)
A9MPF3 2.32e-90 270 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5R5L1 3.64e-90 269 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella gallinarum (strain 287/91 / NCTC 13346)
A7MI37 7.56e-90 268 51 0 251 3 gloB Hydroxyacylglutathione hydrolase Cronobacter sakazakii (strain ATCC BAA-894)
C0Q6N0 9.61e-90 268 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi C (strain RKS4594)
B5R447 3.56e-89 267 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella enteritidis PT4 (strain P125109)
B5FJ56 3.56e-89 267 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella dublin (strain CT_02021853)
Q1LT01 3.21e-81 247 47 1 251 3 gloB Hydroxyacylglutathione hydrolase Baumannia cicadellinicola subsp. Homalodisca coagulata
A1U0V1 1.68e-79 243 45 3 263 3 gloB Hydroxyacylglutathione hydrolase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5E3G3 2.97e-79 242 46 0 246 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio fischeri (strain ATCC 700601 / ES114)
C3LPP0 4.25e-79 241 44 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPX6 4.25e-79 241 44 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F635 4.25e-79 241 44 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8DBD8 5.59e-79 241 46 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio vulnificus (strain CMCP6)
Q7MII4 5.59e-79 241 46 0 251 3 gloB2 Hydroxyacylglutathione hydrolase 2 Vibrio vulnificus (strain YJ016)
B5F9V3 1.21e-78 240 45 0 246 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio fischeri (strain MJ11)
B6EJV4 1.59e-78 240 46 1 252 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio salmonicida (strain LFI1238)
Q3BWP5 7.3e-78 238 44 3 254 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q87MG0 2.52e-76 234 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P57336 7.67e-76 233 45 3 250 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q08889 8.65e-76 233 43 1 251 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A7MY07 1.12e-75 233 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio campbellii (strain ATCC BAA-1116)
Q3IIR9 2.04e-75 232 46 3 257 3 gloB Hydroxyacylglutathione hydrolase Pseudoalteromonas translucida (strain TAC 125)
Q8PBY0 2.22e-75 232 43 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RTE9 2.22e-75 232 43 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain B100)
Q4URM1 2.22e-75 232 43 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain 8004)
Q8PNI0 2.48e-75 232 43 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas axonopodis pv. citri (strain 306)
Q493H8 1.41e-74 230 42 0 251 3 gloB Hydroxyacylglutathione hydrolase Blochmanniella pennsylvanica (strain BPEN)
Q6LN63 2.91e-74 229 47 0 246 3 gloB Hydroxyacylglutathione hydrolase Photobacterium profundum (strain SS9)
A4SPI6 6.84e-73 226 44 4 256 3 gloB Hydroxyacylglutathione hydrolase Aeromonas salmonicida (strain A449)
Q2P6Y4 1.06e-72 225 43 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B7VIP5 2.86e-71 221 41 0 246 3 gloB Hydroxyacylglutathione hydrolase Vibrio atlanticus (strain LGP32)
Q8D3D4 1.08e-70 220 47 3 255 3 gloB Hydroxyacylglutathione hydrolase Wigglesworthia glossinidia brevipalpis
P72933 3.22e-70 219 44 4 261 3 gloB Hydroxyacylglutathione hydrolase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A1SS88 4.33e-70 218 45 4 255 3 gloB Hydroxyacylglutathione hydrolase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q9CMW8 3.04e-69 216 43 2 249 3 gloB Hydroxyacylglutathione hydrolase Pasteurella multocida (strain Pm70)
Q21YF8 2.42e-68 214 43 6 258 3 gloB Hydroxyacylglutathione hydrolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2JVC3 8.15e-67 210 42 4 256 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain JA-3-3Ab)
Q89AN4 1.54e-66 209 43 1 249 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B2IVH7 1.93e-66 209 43 4 261 3 gloB Hydroxyacylglutathione hydrolase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q2JPX4 2.94e-66 209 42 5 256 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q87YS8 6.49e-66 208 43 6 257 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1LL91 9.36e-66 208 40 5 260 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B1WUT9 1.06e-65 207 43 4 261 3 gloB Hydroxyacylglutathione hydrolase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A6VNK4 1.38e-65 206 45 1 216 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q1QW62 1.65e-65 207 44 3 255 3 gloB Hydroxyacylglutathione hydrolase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8YZ99 1.77e-65 207 43 5 261 3 gloB Hydroxyacylglutathione hydrolase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A0KIK2 3.68e-65 206 44 4 256 3 gloB Hydroxyacylglutathione hydrolase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B7K3R6 5.07e-65 206 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Rippkaea orientalis (strain PCC 8801 / RF-1)
A6WMW5 9.21e-65 205 42 5 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS185)
A3MZD3 9.98e-65 204 43 4 247 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BTR9 1.13e-64 204 43 4 247 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H0S9 1.13e-64 204 43 4 247 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q46Z82 1.31e-64 205 40 5 260 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B0TRL8 1.44e-64 204 43 4 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella halifaxensis (strain HAW-EB4)
Q7VM19 1.78e-64 203 39 4 252 3 gloB Hydroxyacylglutathione hydrolase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B3R1Y0 2.68e-64 204 39 5 260 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q4ZVL3 3.03e-64 204 43 5 254 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas syringae pv. syringae (strain B728a)
B0U365 3.07e-64 204 41 2 253 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain M12)
Q87C74 3.58e-64 203 41 2 253 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5S5 3.58e-64 203 41 2 253 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain M23)
Q7NG34 3.58e-64 203 42 4 252 3 gloB Hydroxyacylglutathione hydrolase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A8H589 4.12e-64 203 44 4 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q5QZL0 4.95e-64 203 41 4 257 3 gloB Hydroxyacylglutathione hydrolase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q9PBI4 5.76e-64 203 40 2 253 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain 9a5c)
A4G7G5 1.65e-63 202 41 6 259 3 gloB Hydroxyacylglutathione hydrolase Herminiimonas arsenicoxydans
B1XQ70 2.28e-63 201 42 4 263 3 gloB Hydroxyacylglutathione hydrolase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q0AE32 3.59e-63 201 43 4 255 3 gloB Hydroxyacylglutathione hydrolase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q3MGD2 4.4e-63 201 41 4 261 3 gloB Hydroxyacylglutathione hydrolase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q48KX8 4.52e-63 201 42 6 257 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A9L0E9 5e-63 201 41 5 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS195)
Q4KBH9 8.02e-63 200 43 4 255 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A3D437 8.23e-63 200 41 5 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q65U07 1.63e-62 198 42 3 252 3 gloB Hydroxyacylglutathione hydrolase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B7KEB4 2.01e-62 199 41 4 261 3 gloB Hydroxyacylglutathione hydrolase Gloeothece citriformis (strain PCC 7424)
Q10Y41 2.91e-62 199 41 4 261 3 gloB Hydroxyacylglutathione hydrolase Trichodesmium erythraeum (strain IMS101)
B2FR57 3.6e-62 198 42 1 218 3 gloB Hydroxyacylglutathione hydrolase Stenotrophomonas maltophilia (strain K279a)
B4SLN7 4.98e-62 198 42 1 218 3 gloB Hydroxyacylglutathione hydrolase Stenotrophomonas maltophilia (strain R551-3)
A1S6T3 5.56e-62 198 40 4 259 3 gloB Hydroxyacylglutathione hydrolase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8E5A2 7.95e-62 197 40 5 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS223)
B8F6A3 1.29e-61 196 39 4 252 3 gloB Hydroxyacylglutathione hydrolase Glaesserella parasuis serovar 5 (strain SH0165)
Q5N5S6 2.35e-61 196 41 4 262 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31ND6 2.35e-61 196 41 4 262 3 gloB Hydroxyacylglutathione hydrolase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B0JW10 2.9e-61 196 41 4 261 3 gloB Hydroxyacylglutathione hydrolase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q4QJZ3 3.11e-61 195 39 2 249 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain 86-028NP)
A4Y6B8 4.56e-61 196 41 6 268 3 gloB Hydroxyacylglutathione hydrolase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1WXD9 6.03e-61 195 42 4 249 3 gloB Hydroxyacylglutathione hydrolase Halorhodospira halophila (strain DSM 244 / SL1)
Q12MM2 6.53e-61 195 41 4 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0I3Q7 7.42e-61 194 39 2 249 3 gloB Hydroxyacylglutathione hydrolase Histophilus somni (strain 129Pt)
A1RK78 2.12e-60 194 41 6 268 3 gloB Hydroxyacylglutathione hydrolase Shewanella sp. (strain W3-18-1)
A4XU09 2.89e-60 193 40 5 257 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas mendocina (strain ymp)
Q3KE79 3.85e-60 193 43 4 255 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain Pf0-1)
Q0A751 3.93e-60 193 41 5 256 3 gloB Hydroxyacylglutathione hydrolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B0UU01 4.04e-60 192 39 2 249 3 gloB Hydroxyacylglutathione hydrolase Histophilus somni (strain 2336)
Q2RP80 4.52e-60 193 41 4 255 3 gloB Hydroxyacylglutathione hydrolase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8DIF1 4.77e-60 193 40 4 256 3 gloB Hydroxyacylglutathione hydrolase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q82XW0 5.77e-60 193 42 5 254 3 gloB Hydroxyacylglutathione hydrolase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8EE27 1.83e-59 192 42 6 268 3 gloB Hydroxyacylglutathione hydrolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VQB7 2.37e-59 191 39 1 250 3 gloB Hydroxyacylglutathione hydrolase Blochmanniella floridana
B0BZI8 2.7e-59 191 41 7 266 3 gloB Hydroxyacylglutathione hydrolase Acaryochloris marina (strain MBIC 11017)
A2BQ40 1.11e-58 189 42 3 226 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain AS9601)
Q47FN7 2.74e-58 189 44 2 218 3 gloB Hydroxyacylglutathione hydrolase Dechloromonas aromatica (strain RCB)
P71374 3.46e-58 187 38 3 254 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q88FF3 6.92e-58 187 39 6 256 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5UF43 1.61e-57 186 37 3 259 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain PittGG)
C3K9Q0 2.38e-57 186 38 4 255 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain SBW25)
Q31BX5 2.49e-57 186 40 4 252 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9312)
A3QET2 2.5e-57 186 42 5 254 3 gloB Hydroxyacylglutathione hydrolase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A5W167 2.89e-57 186 38 6 256 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8LDW8 3.2e-57 188 40 5 251 2 GLX2-4 Probable hydroxyacylglutathione hydrolase 2, chloroplastic Arabidopsis thaliana
Q1H188 3.53e-57 185 39 4 253 3 gloB Hydroxyacylglutathione hydrolase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B8HMJ9 4.4e-57 185 43 4 260 3 gloB Hydroxyacylglutathione hydrolase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A0KXS9 5.52e-57 185 41 4 231 3 gloB Hydroxyacylglutathione hydrolase Shewanella sp. (strain ANA-3)
A6VVZ9 2.4e-56 183 40 6 258 3 gloB Hydroxyacylglutathione hydrolase Marinomonas sp. (strain MWYL1)
A5IBE7 2.48e-56 183 38 6 259 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Corby)
B1JBN3 4.24e-56 183 37 6 261 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain W619)
Q5ZVZ3 4.85e-56 182 37 4 255 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
C4LC58 8.37e-56 182 41 4 256 3 gloB Hydroxyacylglutathione hydrolase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B0KN02 8.38e-56 182 38 6 260 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain GB-1)
Q5WX41 8.42e-56 182 38 5 258 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Lens)
A9BEI3 9.21e-56 182 37 5 262 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9211)
Q5X5R2 1.46e-55 181 38 5 258 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Paris)
Q3SIB0 1.99e-55 181 37 4 255 3 gloB Hydroxyacylglutathione hydrolase Thiobacillus denitrificans (strain ATCC 25259)
Q1I7T2 4.79e-55 180 40 6 261 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas entomophila (strain L48)
Q2SJ47 5.79e-55 180 39 3 256 3 gloB Hydroxyacylglutathione hydrolase Hahella chejuensis (strain KCTC 2396)
A3PBT3 4.49e-54 177 39 3 226 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9301)
Q7V6G8 5.1e-54 177 38 3 224 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9313)
Q60BX0 5.17e-54 177 39 5 256 3 gloB Hydroxyacylglutathione hydrolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5GJK5 7.25e-54 177 37 5 262 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain WH7803)
A6V707 8.08e-54 177 40 5 253 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain PA7)
B7VB64 1.27e-53 176 41 5 253 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain LESB58)
Q9I2T1 1.74e-53 176 41 5 253 1 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9SID3 2.69e-53 177 39 5 251 1 At2g31350 Hydroxyacylglutathione hydrolase 2, mitochondrial Arabidopsis thaliana
Q3AL08 4.7e-53 175 38 3 226 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9605)
Q9JXK4 1.18e-52 174 38 6 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0M3 1.18e-52 174 38 6 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup C (strain 053442)
A1KW76 1.63e-52 173 38 6 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A1IPQ8 3.28e-52 172 37 6 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B4RJC7 8.41e-52 172 37 6 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria gonorrhoeae (strain NCCP11945)
Q13F06 8.71e-52 172 39 5 250 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisB5)
Q2J429 9.92e-52 171 38 5 250 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain HaA2)
Q21J46 2.88e-51 171 36 8 269 3 gloB Hydroxyacylglutathione hydrolase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5F7J0 4.39e-51 170 36 6 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7VD23 4.54e-51 170 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q6ML19 5.73e-51 169 38 6 236 3 gloB Hydroxyacylglutathione hydrolase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A4WUN2 7.01e-51 169 36 4 255 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q0I8S8 8.18e-51 169 37 3 225 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9311)
Q3AYI2 1.07e-50 169 38 4 231 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9902)
Q7U5Z8 2.04e-50 168 37 3 224 3 gloB Hydroxyacylglutathione hydrolase Parasynechococcus marenigrum (strain WH8102)
A2C7W3 4.12e-50 167 38 3 226 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9303)
O24495 5.56e-50 169 35 5 251 2 GLX2-1 Hydroxyacylglutathione hydrolase 1, mitochondrial Arabidopsis thaliana
A9IZW8 5.61e-50 167 39 5 247 3 gloB Hydroxyacylglutathione hydrolase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q2N9P7 6.87e-50 167 37 5 255 3 gloB Hydroxyacylglutathione hydrolase Erythrobacter litoralis (strain HTCC2594)
Q6NC62 8.39e-50 167 37 5 250 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5LNN5 1.39e-49 166 34 4 255 3 gloB Hydroxyacylglutathione hydrolase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q31H51 2.36e-49 166 36 3 256 3 gloB Hydroxyacylglutathione hydrolase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
O35952 2.56e-49 167 36 6 260 1 Hagh Hydroxyacylglutathione hydrolase, mitochondrial Rattus norvegicus
Q162S3 3.76e-49 165 35 6 264 3 gloB Hydroxyacylglutathione hydrolase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q3SVQ1 4.57e-49 165 38 5 247 3 gloB Hydroxyacylglutathione hydrolase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
O24496 4.66e-49 165 35 5 260 1 GLX2-2 Hydroxyacylglutathione hydrolase cytoplasmic Arabidopsis thaliana
Q99KB8 1.01e-48 166 36 6 260 1 Hagh Hydroxyacylglutathione hydrolase, mitochondrial Mus musculus
Q92MF8 1.61e-48 163 37 5 256 3 gloB Hydroxyacylglutathione hydrolase Rhizobium meliloti (strain 1021)
Q3B7M2 3.73e-48 164 35 5 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Bos taurus
Q6G1L3 6.13e-48 162 38 5 247 3 gloB Hydroxyacylglutathione hydrolase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q89XT5 6.7e-48 162 37 5 253 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B4F6K2 7.02e-48 163 36 5 260 2 hagh Hydroxyacylglutathione hydrolase, mitochondrial Xenopus tropicalis
Q5ZI23 3.32e-47 162 36 6 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Gallus gallus
Q16775 3.74e-47 161 35 5 260 1 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Homo sapiens
Q28TK3 4.84e-47 159 36 5 255 3 gloB Hydroxyacylglutathione hydrolase Jannaschia sp. (strain CCS1)
Q6FYC3 6.16e-47 159 37 5 247 3 gloB Hydroxyacylglutathione hydrolase Bartonella quintana (strain Toulouse)
Q4FP49 7.76e-47 159 38 6 256 3 gloB Hydroxyacylglutathione hydrolase Pelagibacter ubique (strain HTCC1062)
Q6P963 8.02e-47 160 35 5 260 2 hagh Hydroxyacylglutathione hydrolase, mitochondrial Danio rerio
Q7MQ55 8.55e-47 159 37 5 245 3 gloB1 Hydroxyacylglutathione hydrolase 1 Vibrio vulnificus (strain YJ016)
Q0AM20 1.02e-46 159 38 6 255 3 gloB Hydroxyacylglutathione hydrolase Maricaulis maris (strain MCS10)
A4YKS8 1.35e-46 158 37 7 251 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium sp. (strain ORS 278)
Q21C03 2.88e-46 157 36 5 247 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisB18)
A3PIB4 5.79e-46 157 34 4 255 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q4R6C1 6.61e-46 158 35 6 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Macaca fascicularis
Q98G02 1.13e-45 156 36 5 247 3 gloB Hydroxyacylglutathione hydrolase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q3J436 1.31e-45 156 34 4 255 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q07VA9 3.17e-45 155 38 5 247 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisA53)
A6WXE0 3.87e-44 152 36 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q28333 9.56e-44 152 33 6 263 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial (Fragment) Callithrix jacchus
Q11DS3 1.23e-43 150 33 5 256 3 gloB Hydroxyacylglutathione hydrolase Chelativorans sp. (strain BNC1)
P05446 2.01e-43 150 33 6 266 3 gloB Hydroxyacylglutathione hydrolase Fuscovulum blasticum
Q8N490 2.1e-43 154 36 6 263 1 PNKD Probable hydrolase PNKD Homo sapiens
Q1QQZ1 2.34e-43 150 37 4 224 3 gloB Hydroxyacylglutathione hydrolase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A5ETG1 2.63e-43 150 37 7 251 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q5ZLY2 3.53e-43 150 33 5 260 2 HAGHL Hydroxyacylglutathione hydrolase-like protein Gallus gallus
Q8FYE7 1.05e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella suis biovar 1 (strain 1330)
A5VSR1 1.05e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YJF4 1.05e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57AW2 1.05e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus biovar 1 (strain 9-941)
Q2YLU8 1.05e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus (strain 2308)
Q46GM1 1.17e-42 148 35 4 254 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain NATL2A)
A2C116 1.28e-42 148 35 4 254 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain NATL1A)
B0CIU0 1.31e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RFI1 1.31e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8S2 1.31e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B2S889 1.31e-42 148 35 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus (strain S19)
Q0BWR4 2.72e-42 147 33 5 256 3 gloB Hydroxyacylglutathione hydrolase Hyphomonas neptunium (strain ATCC 15444)
Q8U9W1 2.75e-42 147 36 5 247 3 gloB Hydroxyacylglutathione hydrolase Agrobacterium fabrum (strain C58 / ATCC 33970)
A7YY46 4.91e-42 150 36 6 263 2 PNKD Probable hydrolase PNKD Bos taurus
Q69ZP3 2.71e-41 148 36 6 263 1 Pnkd Probable hydrolase PNKD Mus musculus
P96981 1.02e-39 140 37 5 261 3 gloB Hydroxyacylglutathione hydrolase Rhodobacter capsulatus
A5FZE9 8.29e-39 138 32 4 251 3 gloB Hydroxyacylglutathione hydrolase Acidiphilium cryptum (strain JF-5)
Q26547 8.44e-38 135 34 4 237 2 None Probable hydroxyacylglutathione hydrolase Schistosoma mansoni
O94250 1.12e-37 135 34 8 250 3 SPCC13B11.03c Probable hydroxyacylglutathione hydrolase SPCC13B11.03c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2K3M6 4.26e-37 134 34 5 247 3 gloB Hydroxyacylglutathione hydrolase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9DB32 3.12e-36 132 33 5 260 1 Haghl Hydroxyacylglutathione hydrolase-like protein Mus musculus
Q6PII5 5.43e-35 129 36 3 198 1 HAGHL Hydroxyacylglutathione hydrolase-like protein Homo sapiens
B0TXY0 1.15e-34 127 34 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B0UBD0 1.16e-34 127 30 5 247 3 gloB Hydroxyacylglutathione hydrolase Methylobacterium sp. (strain 4-46)
A0Q7M7 7.47e-34 125 33 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. novicida (strain U112)
Q9UT36 1.04e-33 125 33 8 249 3 glo2 Probable hydroxyacylglutathione hydrolase glo2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1MB56 2.77e-32 121 34 5 247 3 gloB Hydroxyacylglutathione hydrolase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q54MR1 3.86e-32 121 34 9 260 3 hagh Hydroxyacylglutathione hydrolase Dictyostelium discoideum
Q0BMS2 5.83e-32 120 32 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A4E2 5.83e-32 120 32 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain LVS)
A7NB16 5.83e-32 120 32 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B8ICA2 1.71e-31 119 30 5 247 3 gloB Hydroxyacylglutathione hydrolase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A4IWV0 1.75e-30 117 32 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NF43 1.75e-30 117 32 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SFR3 1.75e-30 117 32 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14GJ6 1.75e-30 117 32 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain FSC 198)
Q05584 2.05e-23 98 28 9 269 1 GLO2 Hydroxyacylglutathione hydrolase, cytoplasmic isozyme Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q12320 2.55e-20 90 27 7 259 1 GLO4 Hydroxyacylglutathione hydrolase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q051W5 7.87e-20 89 26 9 275 3 gloB Hydroxyacylglutathione hydrolase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RQ6 7.87e-20 89 26 9 275 3 gloB Hydroxyacylglutathione hydrolase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q2IJC6 1.86e-19 87 28 8 248 3 gloB Hydroxyacylglutathione hydrolase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q12BV7 2.69e-18 84 26 9 255 3 gloB Hydroxyacylglutathione hydrolase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q3JAC4 8.4e-18 83 27 9 259 3 gloB Hydroxyacylglutathione hydrolase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P54501 2.51e-17 80 30 8 193 3 yqgX Probable metallo-hydrolase YqgX Bacillus subtilis (strain 168)
P75849 1.26e-14 73 28 6 190 1 gloC Hydroxyacylglutathione hydrolase GloC Escherichia coli (strain K12)
Q0VBY3 3.9e-14 72 34 6 141 2 HAGHL Hydroxyacylglutathione hydrolase-like protein Bos taurus
Q54EJ5 2.45e-13 71 28 6 189 3 gloB2 Glyoxylase B2 Dictyostelium discoideum
Q9C8L4 4.62e-13 70 28 7 193 1 GLY3 Persulfide dioxygenase ETHE1 homolog, mitochondrial Arabidopsis thaliana
Q57544 1.64e-12 67 28 6 191 3 gloC Hydroxyacylglutathione hydrolase GloC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q49649 2.82e-12 67 30 8 199 3 ML0493 Uncharacterized protein ML0493 Mycobacterium leprae (strain TN)
A7Z4X7 8.35e-12 66 30 6 168 1 baeB Probable polyketide biosynthesis zinc-dependent hydrolase BaeB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q9DCM0 1.58e-11 65 29 7 187 1 Ethe1 Persulfide dioxygenase ETHE1, mitochondrial Mus musculus
Q3T094 1.69e-11 65 29 6 185 2 ETHE1 Persulfide dioxygenase ETHE1, mitochondrial Bos taurus
O95571 2.5e-10 62 28 7 188 1 ETHE1 Persulfide dioxygenase ETHE1, mitochondrial Homo sapiens
O34769 3.13e-10 61 30 6 152 1 pksB Probable polyketide biosynthesis zinc-dependent hydrolase PksB Bacillus subtilis (strain 168)
Q8UAA9 7.29e-10 62 27 6 178 2 blh Beta-lactamase hydrolase-like protein Agrobacterium fabrum (strain C58 / ATCC 33970)
O67893 6.22e-09 57 27 7 189 3 aq_2135 Uncharacterized protein aq_2135 Aquifex aeolicus (strain VF5)
Q9PFB0 8.08e-09 58 26 5 179 2 blh Beta-lactamase hydrolase-like protein Xylella fastidiosa (strain 9a5c)
Q87AD6 1.17e-08 58 27 5 179 3 blh Beta-lactamase hydrolase-like protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P0CU68 2.66e-08 57 33 3 107 1 claF Atrochrysone carboxyl ACP thioesterase Passalora fulva
Q8SSH0 1.44e-07 54 24 5 166 1 ECU02_0580 Probable hydroxyacylglutathione hydrolase ECU02_0580 Encephalitozoon cuniculi (strain GB-M1)
A0A5B8YUX5 2.67e-07 53 29 3 116 2 GME11357 Lactamase-like protein GME11357 Pestalotiopsis microspora
A0A7R7ZLL0 2.97e-07 53 29 4 124 3 AcTE Atrochrysone carboxyl ACP thioesterase Aspergillus chevalieri
E1ACR1 1.14e-06 52 28 6 159 1 notP Lactamase-like protein notP Aspergillus sp. (strain MF297-2)
Q5B0C9 3.33e-06 50 28 3 124 1 aptB Lactamase-like protein aptB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q95Q18 4.08e-06 50 30 5 114 3 Y53F4B.39 Beta-lactamase-like protein 2 homolog Caenorhabditis elegans
Q4WQZ6 6.71e-06 50 30 2 107 2 tpcB Atrochrysone carboxyl ACP thioesterase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
D4AWH0 7.3e-06 50 32 4 116 3 nscB Lactamase-like protein nscB Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Q0CCY4 1.69e-05 48 30 4 118 1 gedB Atrochrysone carboxyl ACP thioesterase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q9VLS9 2.05e-05 48 32 6 131 2 CG12375 Beta-lactamase-like protein 2 homolog Drosophila melanogaster
Q4WA58 2.55e-05 48 28 3 116 3 nscB Lactamase-like protein nscB Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
D4CZZ5 2.74e-05 47 35 2 87 3 nscB Lactamase-like protein nscB Trichophyton verrucosum (strain HKI 0517)
A1D8J2 3.22e-05 47 27 4 118 3 nscB Lactamase-like protein nscB Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
D7PHZ8 3.95e-05 47 26 5 138 1 vrtG Lactamase-like protein vrtG Penicillium aethiopicum
G3KLH5 4.4e-05 47 33 2 87 1 adaB Lactamase-like protein adaB Aspergillus niger
A2QX23 4.4e-05 47 33 2 87 1 adaB Lactamase-like protein adaB Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
F2T0M3 5.45e-05 47 28 3 116 3 nscB Lactamase-like protein nscB Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
A0A067XMV3 5.48e-05 47 28 2 107 2 ptaB Lactamase-like protein ptaB Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
F2S702 7.66e-05 46 31 4 116 3 nscB Lactamase-like protein nscB Trichophyton tonsurans (strain CBS 112818)
F2PWS8 7.66e-05 46 31 4 116 3 nscB Lactamase-like protein nscB Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q561R9 8.84e-05 46 27 9 194 2 Lactb2 Endoribonuclease LACTB2 Rattus norvegicus
Q4W945 0.000105 46 26 6 153 1 encB Atrochrysone carboxyl ACP thioesterase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q5BH31 0.000107 46 27 5 123 3 mdpF Atrochrysone carboxyl ACP thioesterase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
M3ANL0 0.000137 45 23 7 168 2 MYCFIDRAFT_190111 Atrochrysone carboxyl ACP thioesterase MYCFIDRAFT_190111 Pseudocercospora fijiensis (strain CIRAD86)
A0A4P8DJU1 0.000143 45 29 4 120 3 dmxR1 Atrochrysone carboxyl ACP thioesterase dmxR1 Cryptosporiopsis sp. (strain 8999)
A0A1L9WLF1 0.000148 45 27 4 116 1 AacuM Atrochrysone carboxyl ACP thioesterase AacuM Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q5AXB0 0.000263 45 26 4 126 1 pkgB Thioesterase pkgB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O34910 0.000266 44 29 4 141 3 yobT Uncharacterized protein YobT Bacillus subtilis (strain 168)
A0A2I1C3U0 0.000302 45 27 5 124 1 nsrC Atrochrysone carboxyl ACP thioesterase nsrC Aspergillus novofumigatus (strain IBT 16806)
A0A411PQM3 0.000352 44 27 4 120 3 AgnL7 Atrochrysone carboxyl ACP thioesterase AgnL7 Paecilomyces divaricatus
Q0V9A9 0.000407 44 31 6 124 2 lactb2 Endoribonuclease LACTB2 Xenopus tropicalis
M1WCF7 0.000724 43 29 3 105 2 CPUR_05436 Atrochrysone carboxyl ACP thioesterase CPUR_05436 Claviceps purpurea (strain 20.1)
Q6NYF0 0.000732 43 31 6 123 2 lactb2 Endoribonuclease LACTB2 Danio rerio
P37502 0.000795 43 26 6 149 3 yybB Probable metallo-hydrolase YybB Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01085
Feature type CDS
Gene gloB
Product hydroxyacylglutathione hydrolase
Location 269170 - 269925 (strand: -1)
Length 756 (nucleotides) / 251 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1867
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00753 Metallo-beta-lactamase superfamily
PF16123 Hydroxyacylglutathione hydrolase C-terminus

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0491 General function prediction only (R) R Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01069 hydroxyacylglutathione hydrolase [EC:3.1.2.6] Pyruvate metabolism
Metabolic pathways		 -

Protein Sequence

MELIRIPALSDNYIWLLSNENSECVIVDPSQAKPVIDIISQRSLTPVAILLTHHHEDHVGGVAGLVSKYPNIEVFGPQETQTKGANKIIHDQEHIIVDSFSFLVIGTPGHTLGHVAYYSEPYLFCGDTLFSGGCGRLFEGSAQQMFSSLQKLMALPDNTLICCAHEYTLANLTFAHHIMPKNPDITDYLNKVTEMRHHLQPTVPITLKNEKNINLFLKSDDIDLQRILGITSNTYAPIKTFTKLRELKDNF

Flanking regions ( +/- flanking 50bp)

GCGCTGCTTTCATCGTTTAACCCTTTTATATTTATAAGTAAGGTAACTTTATGGAGCTTATCAGAATTCCCGCTTTATCCGATAACTACATTTGGCTATTAAGTAATGAAAATAGTGAATGTGTGATTGTCGATCCTTCCCAAGCCAAACCGGTTATAGACATCATCTCACAACGTTCATTAACACCTGTCGCTATTTTGTTAACTCATCACCACGAAGATCATGTTGGTGGTGTTGCTGGGTTGGTTAGTAAATATCCTAACATTGAGGTTTTTGGTCCACAAGAAACACAAACTAAAGGCGCTAATAAAATTATTCATGATCAAGAACACATTATCGTTGATTCTTTTTCTTTTTTAGTCATCGGAACACCAGGCCATACATTAGGTCATGTCGCCTACTATAGCGAACCTTATTTATTTTGCGGTGACACGCTATTTTCCGGCGGTTGCGGACGTTTATTTGAAGGTAGTGCACAACAAATGTTTAGCTCATTACAAAAGTTAATGGCATTACCTGATAACACCTTAATTTGTTGTGCCCATGAGTATACATTAGCTAACTTGACCTTTGCGCACCATATTATGCCAAAAAATCCTGATATTACCGATTATTTAAACAAAGTTACTGAAATGCGCCATCATTTGCAACCAACAGTGCCGATAACACTGAAAAATGAAAAGAATATTAATCTTTTTCTAAAATCTGACGATATTGATTTACAAAGAATTTTAGGTATAACTTCTAATACTTATGCTCCAATAAAGACATTTACAAAATTAAGAGAATTAAAAGACAACTTTTAGTTCCTATCGGTTGTTTTATTTGGGAACACTAGTATTATTTAGGGCAAAAA