Homologs in group_1867

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13955 FBDBKF_13955 78.9 Morganella morganii S1 gloB hydroxyacylglutathione hydrolase
EHELCC_11625 EHELCC_11625 78.9 Morganella morganii S2 gloB hydroxyacylglutathione hydrolase
NLDBIP_11970 NLDBIP_11970 78.9 Morganella morganii S4 gloB hydroxyacylglutathione hydrolase
LHKJJB_11830 LHKJJB_11830 78.9 Morganella morganii S3 gloB hydroxyacylglutathione hydrolase
HKOGLL_10440 HKOGLL_10440 78.9 Morganella morganii S5 gloB hydroxyacylglutathione hydrolase
PMI_RS01085 PMI_RS01085 57.4 Proteus mirabilis HI4320 gloB hydroxyacylglutathione hydrolase

Distribution of the homologs in the orthogroup group_1867

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1867

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JKA9 5.45e-104 304 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DC67 9.52e-104 304 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A4TL56 7.94e-103 301 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis (strain Pestoides F)
Q1CFI4 8.21e-103 301 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WHW5 8.21e-103 301 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis
Q1CAJ7 8.21e-103 301 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis bv. Antiqua (strain Antiqua)
B1JR44 1.24e-102 301 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667M5 1.24e-102 301 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KAD1 1.24e-102 301 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFK5 1.24e-102 301 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D1V5 2.2e-102 300 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N809 2.95e-99 292 58 1 251 3 gloB Hydroxyacylglutathione hydrolase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C4K7Z9 1.83e-98 290 54 1 251 3 gloB Hydroxyacylglutathione hydrolase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C5BEP2 8.19e-98 289 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Edwardsiella ictaluri (strain 93-146)
A4W6V2 9.54e-98 288 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Enterobacter sp. (strain 638)
Q2NVG1 1.14e-95 283 52 1 251 3 gloB Hydroxyacylglutathione hydrolase Sodalis glossinidius (strain morsitans)
Q8Z983 2.4e-95 283 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella typhi
A8GA75 1.03e-93 278 57 3 254 3 gloB Hydroxyacylglutathione hydrolase Serratia proteamaculans (strain 568)
B2VHJ7 2.37e-92 275 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6T510 3.04e-92 275 50 0 251 3 gloB Hydroxyacylglutathione hydrolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y1G4 8.13e-92 273 50 0 251 3 gloB Hydroxyacylglutathione hydrolase Klebsiella pneumoniae (strain 342)
Q8ZRM2 1.13e-91 273 53 0 251 1 gloB Hydroxyacylglutathione hydrolase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5R5L1 1.58e-91 273 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5BDW7 1.82e-91 273 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi A (strain AKU_12601)
Q5PFD6 1.82e-91 273 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TYG8 2.64e-91 272 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella schwarzengrund (strain CVM19633)
A9MZ21 2.64e-91 272 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SV37 2.64e-91 272 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella newport (strain SL254)
B4TK83 2.64e-91 272 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella heidelberg (strain SL476)
Q57SZ8 2.64e-91 272 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella choleraesuis (strain SC-B67)
B5F8X0 2.64e-91 272 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella agona (strain SL483)
B6HZS5 5.74e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain SE11)
B7M211 9.49e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O8 (strain IAI1)
B7LHB8 9.49e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain 55989 / EAEC)
C0Q6N0 9.91e-91 271 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi C (strain RKS4594)
Q3Z5F1 1.01e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella sonnei (strain Ss046)
B2U350 1.01e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7ZHU8 1.01e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LHM1 1.04e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKW6 1.04e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0AC84 1.14e-90 271 52 0 251 1 gloB Hydroxyacylglutathione hydrolase GloB Escherichia coli (strain K12)
B1XD76 1.14e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain K12 / DH10B)
C4ZRU9 1.14e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z0I6 1.14e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AC85 1.14e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O157:H7
A7ZWF4 1.19e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O9:H4 (strain HS)
A8AKR2 1.21e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7N874 1.3e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FKY7 2.37e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83MC1 2.43e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella flexneri
Q0T802 2.43e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella flexneri serotype 5b (strain 8401)
Q325T4 2.43e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella boydii serotype 4 (strain Sb227)
A1A7Q3 2.74e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O1:K1 / APEC
B7MBI8 2.74e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O45:K1 (strain S88 / ExPEC)
B5R447 3.12e-90 270 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella enteritidis PT4 (strain P125109)
B5FJ56 3.12e-90 270 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella dublin (strain CT_02021853)
Q1RFX9 3.33e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain UTI89 / UPEC)
A9MPF3 3.44e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B1IPU6 4.47e-90 269 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TLC5 4.94e-90 269 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UJA8 4.94e-90 269 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LW87 8.16e-90 268 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7MQ21 2.18e-89 267 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O81 (strain ED1a)
Q32JQ1 4.43e-88 264 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella dysenteriae serotype 1 (strain Sd197)
A7MI37 2.02e-86 260 50 0 251 3 gloB Hydroxyacylglutathione hydrolase Cronobacter sakazakii (strain ATCC BAA-894)
B6EJV4 3.53e-86 259 50 1 252 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio salmonicida (strain LFI1238)
Q1LT01 2.52e-79 242 47 1 251 3 gloB Hydroxyacylglutathione hydrolase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q5E3G3 2.72e-79 242 46 0 251 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q08889 4.16e-79 241 44 1 251 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B5F9V3 5.18e-79 241 46 0 251 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio fischeri (strain MJ11)
P57336 2.71e-77 237 42 1 249 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8DBD8 4.46e-77 236 45 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio vulnificus (strain CMCP6)
Q7MII4 4.46e-77 236 45 0 251 3 gloB2 Hydroxyacylglutathione hydrolase 2 Vibrio vulnificus (strain YJ016)
C3LPP0 2.83e-75 231 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPX6 2.83e-75 231 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F635 2.83e-75 231 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4SPI6 6.98e-75 231 49 4 254 3 gloB Hydroxyacylglutathione hydrolase Aeromonas salmonicida (strain A449)
Q6LN63 2.08e-74 229 48 0 246 3 gloB Hydroxyacylglutathione hydrolase Photobacterium profundum (strain SS9)
Q87MG0 6.45e-74 228 44 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MY07 9.04e-74 228 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio campbellii (strain ATCC BAA-1116)
A1SS88 5.82e-72 223 46 6 257 3 gloB Hydroxyacylglutathione hydrolase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q3BWP5 1.22e-71 223 43 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B7VIP5 1.32e-71 222 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio atlanticus (strain LGP32)
Q8PBY0 1.59e-71 222 46 2 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RTE9 1.59e-71 222 46 2 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain B100)
Q4URM1 1.59e-71 222 46 2 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain 8004)
Q46Z82 7.09e-71 221 44 5 260 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B3R1Y0 7.41e-71 221 44 5 260 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q8PNI0 9.65e-71 220 43 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas axonopodis pv. citri (strain 306)
Q493H8 1.33e-70 219 41 0 251 3 gloB Hydroxyacylglutathione hydrolase Blochmanniella pennsylvanica (strain BPEN)
Q3IIR9 9.56e-70 218 45 2 256 3 gloB Hydroxyacylglutathione hydrolase Pseudoalteromonas translucida (strain TAC 125)
Q89AN4 1.27e-69 217 41 1 250 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q1LL91 5.37e-69 216 44 5 260 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q5QZL0 6.73e-69 215 43 4 254 3 gloB Hydroxyacylglutathione hydrolase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A0KIK2 1.2e-68 215 49 4 254 3 gloB Hydroxyacylglutathione hydrolase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8D3D4 1.51e-68 214 44 3 253 3 gloB Hydroxyacylglutathione hydrolase Wigglesworthia glossinidia brevipalpis
B1WUT9 7.32e-68 213 45 5 261 3 gloB Hydroxyacylglutathione hydrolase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A1U0V1 1.03e-67 213 44 4 263 3 gloB Hydroxyacylglutathione hydrolase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A4G7G5 1.28e-67 212 44 6 259 3 gloB Hydroxyacylglutathione hydrolase Herminiimonas arsenicoxydans
Q0AE32 2.2e-67 211 46 6 256 3 gloB Hydroxyacylglutathione hydrolase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q7NG34 3.65e-67 211 45 4 256 3 gloB Hydroxyacylglutathione hydrolase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q4KBH9 6.6e-67 210 47 5 256 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B7KEB4 3.25e-66 209 44 4 261 3 gloB Hydroxyacylglutathione hydrolase Gloeothece citriformis (strain PCC 7424)
A6WMW5 4.31e-66 209 43 4 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS185)
B8E5A2 5.24e-66 208 44 6 265 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS223)
Q3KE79 5.55e-66 208 47 5 256 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain Pf0-1)
Q8DIF1 6.22e-66 208 44 5 257 3 gloB Hydroxyacylglutathione hydrolase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q1I7T2 8.7e-66 207 46 6 260 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas entomophila (strain L48)
A3D437 3.32e-65 206 43 4 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q87YS8 5.82e-65 206 44 5 254 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B1XQ70 7.89e-65 205 44 4 263 3 gloB Hydroxyacylglutathione hydrolase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q3MGD2 1.42e-64 204 44 4 261 3 gloB Hydroxyacylglutathione hydrolase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A9L0E9 1.47e-64 204 44 6 265 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS195)
B4SLN7 1.56e-64 204 42 2 253 3 gloB Hydroxyacylglutathione hydrolase Stenotrophomonas maltophilia (strain R551-3)
Q2P6Y4 1.94e-64 204 41 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B7K3R6 1.95e-64 204 43 5 261 3 gloB Hydroxyacylglutathione hydrolase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q9PBI4 2.24e-64 204 44 3 254 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain 9a5c)
Q21YF8 2.33e-64 204 44 6 258 3 gloB Hydroxyacylglutathione hydrolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q65U07 5.68e-64 202 47 3 225 3 gloB Hydroxyacylglutathione hydrolase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5N5S6 8.9e-64 202 45 8 259 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31ND6 8.9e-64 202 45 8 259 3 gloB Hydroxyacylglutathione hydrolase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q1QW62 1.12e-63 202 46 4 256 3 gloB Hydroxyacylglutathione hydrolase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B0U365 1.15e-63 202 44 3 254 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain M12)
Q2RP80 1.17e-63 202 43 4 255 3 gloB Hydroxyacylglutathione hydrolase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q87C74 1.32e-63 202 44 3 254 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5S5 1.32e-63 202 44 3 254 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain M23)
Q82XW0 1.59e-63 202 44 4 250 3 gloB Hydroxyacylglutathione hydrolase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q10Y41 1.99e-63 201 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Trichodesmium erythraeum (strain IMS101)
Q12MM2 2.05e-63 201 43 4 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A4XU09 2.53e-63 201 43 6 258 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas mendocina (strain ymp)
Q8YZ99 3.11e-63 201 43 4 261 3 gloB Hydroxyacylglutathione hydrolase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B2IVH7 3.5e-63 201 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A1S6T3 4.16e-63 201 42 4 259 3 gloB Hydroxyacylglutathione hydrolase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KXS9 5.83e-63 201 45 3 227 3 gloB Hydroxyacylglutathione hydrolase Shewanella sp. (strain ANA-3)
P72933 6.29e-63 200 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
C3K9Q0 2.09e-62 199 44 5 256 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain SBW25)
Q47FN7 3.28e-62 199 43 4 266 3 gloB Hydroxyacylglutathione hydrolase Dechloromonas aromatica (strain RCB)
Q48KX8 3.3e-62 198 43 6 255 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6VNK4 7.92e-62 197 46 1 212 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q2JPX4 9.29e-62 197 42 4 256 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain JA-2-3B'a(2-13))
B0JW10 9.38e-62 197 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B2FR57 1.01e-61 197 42 2 253 3 gloB Hydroxyacylglutathione hydrolase Stenotrophomonas maltophilia (strain K279a)
A3QET2 1.32e-61 197 43 4 253 3 gloB Hydroxyacylglutathione hydrolase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q9CMW8 1.68e-61 196 40 2 249 3 gloB Hydroxyacylglutathione hydrolase Pasteurella multocida (strain Pm70)
Q7VQB7 2.47e-61 196 38 1 252 3 gloB Hydroxyacylglutathione hydrolase Blochmanniella floridana
Q4ZVL3 6.58e-61 195 43 5 254 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas syringae pv. syringae (strain B728a)
Q8EE27 1.07e-60 195 46 4 228 3 gloB Hydroxyacylglutathione hydrolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0TRL8 1.38e-60 194 43 4 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella halifaxensis (strain HAW-EB4)
Q2JVC3 2e-60 194 43 5 260 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain JA-3-3Ab)
B0KN02 2e-59 191 43 7 260 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain GB-1)
B0BTR9 4.02e-59 190 42 4 252 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H0S9 4.02e-59 190 42 4 252 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A8H589 4.18e-59 191 42 5 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A5W167 4.71e-59 191 42 6 260 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q5WX41 4.72e-59 190 40 4 255 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Lens)
A3MZD3 4.83e-59 189 42 4 252 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q4QJZ3 5.07e-59 189 39 2 249 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain 86-028NP)
Q2SJ47 6.42e-59 190 42 3 256 3 gloB Hydroxyacylglutathione hydrolase Hahella chejuensis (strain KCTC 2396)
Q5ZVZ3 1.16e-58 189 39 4 255 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B0BZI8 1.33e-58 189 41 4 261 3 gloB Hydroxyacylglutathione hydrolase Acaryochloris marina (strain MBIC 11017)
A5IBE7 1.52e-58 189 39 4 255 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Corby)
A4Y6B8 1.73e-58 189 45 4 227 3 gloB Hydroxyacylglutathione hydrolase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q3SIB0 2.03e-58 189 43 4 255 3 gloB Hydroxyacylglutathione hydrolase Thiobacillus denitrificans (strain ATCC 25259)
Q1H188 2.76e-58 188 42 5 254 3 gloB Hydroxyacylglutathione hydrolase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A6V707 2.89e-58 188 42 5 253 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain PA7)
Q88FF3 6.15e-58 187 41 6 260 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1RK78 7.37e-58 187 45 4 227 3 gloB Hydroxyacylglutathione hydrolase Shewanella sp. (strain W3-18-1)
B7VB64 9.01e-58 187 41 5 253 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain LESB58)
Q5X5R2 1.52e-57 186 39 4 255 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Paris)
Q9I2T1 1.62e-57 186 41 5 253 1 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1WXD9 1.94e-57 186 42 4 248 3 gloB Hydroxyacylglutathione hydrolase Halorhodospira halophila (strain DSM 244 / SL1)
B1JBN3 2.28e-57 186 42 6 260 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain W619)
A2BQ40 2.76e-56 183 41 5 236 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain AS9601)
Q6ML19 3.5e-56 183 41 6 236 3 gloB Hydroxyacylglutathione hydrolase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
P71374 4.7e-56 182 38 3 254 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A9BEI3 8.18e-56 182 40 3 228 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9211)
Q0A751 1.01e-55 182 41 4 254 3 gloB Hydroxyacylglutathione hydrolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B8F6A3 3.05e-55 180 39 4 252 3 gloB Hydroxyacylglutathione hydrolase Glaesserella parasuis serovar 5 (strain SH0165)
B8HMJ9 5.16e-55 180 43 4 260 3 gloB Hydroxyacylglutathione hydrolase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A5UF43 5.25e-55 179 37 3 259 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain PittGG)
Q60BX0 8.77e-55 179 41 5 256 3 gloB Hydroxyacylglutathione hydrolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
C4LC58 1.47e-54 179 40 5 266 3 gloB Hydroxyacylglutathione hydrolase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A3PBT3 4.84e-54 177 41 5 236 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9301)
Q31BX5 5.06e-54 177 39 3 225 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9312)
A6VVZ9 2.84e-53 176 41 8 259 3 gloB Hydroxyacylglutathione hydrolase Marinomonas sp. (strain MWYL1)
Q3AYI2 3e-53 175 40 3 227 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9902)
Q8LDW8 6.72e-53 177 39 5 256 2 GLX2-4 Probable hydroxyacylglutathione hydrolase 2, chloroplastic Arabidopsis thaliana
Q0I3Q7 1.24e-52 173 38 1 221 3 gloB Hydroxyacylglutathione hydrolase Histophilus somni (strain 129Pt)
Q7VM19 1.56e-52 173 39 3 223 3 gloB Hydroxyacylglutathione hydrolase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q0AM20 1.77e-52 174 41 7 256 3 gloB Hydroxyacylglutathione hydrolase Maricaulis maris (strain MCS10)
Q3AL08 3.15e-52 172 38 3 226 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9605)
Q7V6G8 3.38e-52 173 39 3 221 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9313)
B0UU01 3.54e-52 172 38 1 221 3 gloB Hydroxyacylglutathione hydrolase Histophilus somni (strain 2336)
A4YKS8 3.87e-52 172 39 6 253 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium sp. (strain ORS 278)
Q89XT5 5.72e-52 172 38 5 254 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A5GJK5 1.5e-51 171 43 4 225 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain WH7803)
Q2J429 2.05e-51 171 43 5 223 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain HaA2)
Q5LNN5 2.25e-51 171 37 5 256 3 gloB Hydroxyacylglutathione hydrolase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q21J46 3.93e-51 171 37 6 255 3 gloB Hydroxyacylglutathione hydrolase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q6NC62 4.26e-51 170 39 6 252 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7VD23 5.22e-51 170 34 4 256 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q6G1L3 5.57e-51 169 41 6 248 3 gloB Hydroxyacylglutathione hydrolase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q3SVQ1 1.54e-50 169 40 6 249 3 gloB Hydroxyacylglutathione hydrolase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q9SID3 2.81e-50 170 37 5 256 1 At2g31350 Hydroxyacylglutathione hydrolase 2, mitochondrial Arabidopsis thaliana
Q8FYE7 2.83e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella suis biovar 1 (strain 1330)
A5VSR1 2.83e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YJF4 2.83e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57AW2 2.83e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus biovar 1 (strain 9-941)
Q2YLU8 2.83e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus (strain 2308)
O24496 2.91e-50 168 37 5 260 1 GLX2-2 Hydroxyacylglutathione hydrolase cytoplasmic Arabidopsis thaliana
A5ETG1 2.91e-50 168 39 6 253 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B0CIU0 3.51e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RFI1 3.51e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8S2 3.51e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B2S889 3.51e-50 168 39 6 257 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus (strain S19)
A6WXE0 7.22e-50 167 39 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q11DS3 1.34e-49 166 37 5 256 3 gloB Hydroxyacylglutathione hydrolase Chelativorans sp. (strain BNC1)
A9IZW8 1.71e-49 166 38 5 247 3 gloB Hydroxyacylglutathione hydrolase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q0I8S8 2.23e-49 166 38 4 226 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9311)
Q13F06 4.06e-49 165 41 5 223 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisB5)
A2C7W3 6.66e-49 164 40 4 225 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9303)
Q9JXK4 6.67e-49 164 39 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0M3 6.67e-49 164 39 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup C (strain 053442)
A1KW76 9.22e-49 164 39 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A1IPQ8 1.61e-48 163 38 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B4RJC7 2.3e-48 163 38 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria gonorrhoeae (strain NCCP11945)
Q6FYC3 3.5e-48 162 39 6 248 3 gloB Hydroxyacylglutathione hydrolase Bartonella quintana (strain Toulouse)
Q98G02 8.86e-48 161 37 5 256 3 gloB Hydroxyacylglutathione hydrolase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5F7J0 9.06e-48 161 38 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1QQZ1 1.12e-47 161 39 6 249 3 gloB Hydroxyacylglutathione hydrolase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q7U5Z8 1.58e-47 160 38 4 226 3 gloB Hydroxyacylglutathione hydrolase Parasynechococcus marenigrum (strain WH8102)
A3PIB4 1.59e-47 160 36 4 255 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q3J436 2.41e-47 160 36 4 255 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q46GM1 3.95e-47 159 38 4 228 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain NATL2A)
Q21C03 4.51e-47 159 37 7 259 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisB18)
A2C116 4.74e-47 159 38 4 228 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain NATL1A)
Q2N9P7 1.26e-46 158 37 5 255 3 gloB Hydroxyacylglutathione hydrolase Erythrobacter litoralis (strain HTCC2594)
Q6P963 7.95e-46 158 36 7 261 2 hagh Hydroxyacylglutathione hydrolase, mitochondrial Danio rerio
P05446 1.66e-45 155 35 5 264 3 gloB Hydroxyacylglutathione hydrolase Fuscovulum blasticum
Q162S3 2.02e-45 155 37 6 256 3 gloB Hydroxyacylglutathione hydrolase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q07VA9 4.48e-45 154 37 5 254 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisA53)
Q5ZLY2 4.49e-45 155 38 8 263 2 HAGHL Hydroxyacylglutathione hydrolase-like protein Gallus gallus
A4WUN2 5.99e-45 154 36 4 255 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q31H51 1.31e-44 154 35 4 258 3 gloB Hydroxyacylglutathione hydrolase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
O24495 1.65e-44 155 35 5 246 2 GLX2-1 Hydroxyacylglutathione hydrolase 1, mitochondrial Arabidopsis thaliana
Q4FP49 2.11e-44 152 34 4 255 3 gloB Hydroxyacylglutathione hydrolase Pelagibacter ubique (strain HTCC1062)
B4F6K2 2.37e-44 154 36 6 260 2 hagh Hydroxyacylglutathione hydrolase, mitochondrial Xenopus tropicalis
Q0BWR4 5.23e-44 152 36 6 256 3 gloB Hydroxyacylglutathione hydrolase Hyphomonas neptunium (strain ATCC 15444)
Q92MF8 7.7e-44 151 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Rhizobium meliloti (strain 1021)
Q8U9W1 2.07e-43 150 37 5 247 3 gloB Hydroxyacylglutathione hydrolase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3B7M2 3.1e-43 151 35 6 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Bos taurus
Q8N490 3.93e-43 153 38 3 239 1 PNKD Probable hydrolase PNKD Homo sapiens
Q7MQ55 5.46e-43 149 34 5 246 3 gloB1 Hydroxyacylglutathione hydrolase 1 Vibrio vulnificus (strain YJ016)
A7YY46 8.68e-43 152 38 3 236 2 PNKD Probable hydrolase PNKD Bos taurus
O35952 2.15e-42 149 34 6 260 1 Hagh Hydroxyacylglutathione hydrolase, mitochondrial Rattus norvegicus
Q99KB8 2.75e-42 149 35 6 260 1 Hagh Hydroxyacylglutathione hydrolase, mitochondrial Mus musculus
Q5ZI23 3.03e-42 149 35 6 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Gallus gallus
Q69ZP3 4.81e-42 150 37 3 239 1 Pnkd Probable hydrolase PNKD Mus musculus
Q28TK3 7e-42 146 37 5 255 3 gloB Hydroxyacylglutathione hydrolase Jannaschia sp. (strain CCS1)
Q4R6C1 1.16e-41 147 34 5 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Macaca fascicularis
Q16775 1.06e-40 145 34 6 260 1 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Homo sapiens
Q2K3M6 3.58e-39 139 36 6 257 3 gloB Hydroxyacylglutathione hydrolase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q28333 4.1e-39 140 33 6 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial (Fragment) Callithrix jacchus
P96981 1.12e-37 135 41 4 255 3 gloB Hydroxyacylglutathione hydrolase Rhodobacter capsulatus
Q1MB56 8.35e-37 133 40 4 183 3 gloB Hydroxyacylglutathione hydrolase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A5FZE9 1.1e-35 130 35 4 251 3 gloB Hydroxyacylglutathione hydrolase Acidiphilium cryptum (strain JF-5)
Q54MR1 5.14e-35 129 31 8 269 3 hagh Hydroxyacylglutathione hydrolase Dictyostelium discoideum
Q9UT36 1.01e-34 128 36 7 218 3 glo2 Probable hydroxyacylglutathione hydrolase glo2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9DB32 1.86e-34 128 33 7 261 1 Haghl Hydroxyacylglutathione hydrolase-like protein Mus musculus
B8ICA2 3.1e-33 124 32 5 247 3 gloB Hydroxyacylglutathione hydrolase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q26547 5.15e-33 123 33 8 247 2 None Probable hydroxyacylglutathione hydrolase Schistosoma mansoni
O94250 6.97e-33 123 34 8 230 3 SPCC13B11.03c Probable hydroxyacylglutathione hydrolase SPCC13B11.03c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B0UBD0 1.97e-31 119 31 5 247 3 gloB Hydroxyacylglutathione hydrolase Methylobacterium sp. (strain 4-46)
Q6PII5 3.05e-31 119 36 3 195 1 HAGHL Hydroxyacylglutathione hydrolase-like protein Homo sapiens
B0TXY0 3.5e-31 118 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A0Q7M7 1.31e-30 117 34 4 212 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. novicida (strain U112)
Q0BMS2 5.2e-30 115 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A4E2 5.2e-30 115 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain LVS)
A7NB16 5.2e-30 115 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IWV0 1.4e-28 112 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NF43 1.4e-28 112 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SFR3 1.4e-28 112 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14GJ6 1.4e-28 112 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain FSC 198)
Q2IJC6 2.51e-21 92 30 6 254 3 gloB Hydroxyacylglutathione hydrolase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q3JAC4 5.68e-20 89 28 7 238 3 gloB Hydroxyacylglutathione hydrolase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q05584 1.56e-19 88 27 9 269 1 GLO2 Hydroxyacylglutathione hydrolase, cytoplasmic isozyme Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q051W5 4e-19 87 27 12 271 3 gloB Hydroxyacylglutathione hydrolase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RQ6 4e-19 87 27 12 271 3 gloB Hydroxyacylglutathione hydrolase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q12BV7 5.09e-19 86 30 5 201 3 gloB Hydroxyacylglutathione hydrolase Polaromonas sp. (strain JS666 / ATCC BAA-500)
P75849 1.19e-17 82 31 7 190 1 gloC Hydroxyacylglutathione hydrolase GloC Escherichia coli (strain K12)
P54501 2.34e-17 81 30 7 186 3 yqgX Probable metallo-hydrolase YqgX Bacillus subtilis (strain 168)
Q12320 7e-15 75 28 7 233 1 GLO4 Hydroxyacylglutathione hydrolase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O67893 7.69e-13 68 29 11 205 3 aq_2135 Uncharacterized protein aq_2135 Aquifex aeolicus (strain VF5)
A7Z4X7 9.61e-13 68 30 7 169 1 baeB Probable polyketide biosynthesis zinc-dependent hydrolase BaeB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q87AD6 1.15e-12 70 30 7 182 3 blh Beta-lactamase hydrolase-like protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9C8L4 1.16e-12 69 26 8 235 1 GLY3 Persulfide dioxygenase ETHE1 homolog, mitochondrial Arabidopsis thaliana
Q9PFB0 4.26e-12 68 30 8 182 2 blh Beta-lactamase hydrolase-like protein Xylella fastidiosa (strain 9a5c)
Q49649 1.93e-11 65 31 8 184 3 ML0493 Uncharacterized protein ML0493 Mycobacterium leprae (strain TN)
Q57544 4.64e-11 63 27 9 194 3 gloC Hydroxyacylglutathione hydrolase GloC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O95571 8.76e-11 63 33 8 184 1 ETHE1 Persulfide dioxygenase ETHE1, mitochondrial Homo sapiens
Q3T094 1.98e-10 62 32 7 183 2 ETHE1 Persulfide dioxygenase ETHE1, mitochondrial Bos taurus
Q8UAA9 2.15e-10 63 28 10 228 2 blh Beta-lactamase hydrolase-like protein Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9DCM0 7.13e-10 61 31 7 183 1 Ethe1 Persulfide dioxygenase ETHE1, mitochondrial Mus musculus
Q54EJ5 3.07e-09 59 28 5 157 3 gloB2 Glyoxylase B2 Dictyostelium discoideum
Q0VBY3 4.15e-09 58 31 2 119 2 HAGHL Hydroxyacylglutathione hydrolase-like protein Bos taurus
O34769 4.9e-09 58 28 6 153 1 pksB Probable polyketide biosynthesis zinc-dependent hydrolase PksB Bacillus subtilis (strain 168)
E1ACR1 5.76e-09 58 32 4 118 1 notP Lactamase-like protein notP Aspergillus sp. (strain MF297-2)
D7PHZ8 1.1e-08 58 31 5 140 1 vrtG Lactamase-like protein vrtG Penicillium aethiopicum
Q8SSH0 1.67e-08 57 22 6 205 1 ECU02_0580 Probable hydroxyacylglutathione hydrolase ECU02_0580 Encephalitozoon cuniculi (strain GB-M1)
Q5AXB0 3.04e-08 57 32 4 124 1 pkgB Thioesterase pkgB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C5FM60 6.16e-08 56 32 3 119 3 nscB Lactamase-like protein nscB Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
P0CU68 1.1e-07 55 33 3 103 1 claF Atrochrysone carboxyl ACP thioesterase Passalora fulva
A0A4P8DJU1 1.11e-07 55 29 5 150 3 dmxR1 Atrochrysone carboxyl ACP thioesterase dmxR1 Cryptosporiopsis sp. (strain 8999)
Q6NYF0 1.24e-07 55 31 5 134 2 lactb2 Endoribonuclease LACTB2 Danio rerio
A0A5B8YUX5 1.3e-07 55 28 3 126 2 GME11357 Lactamase-like protein GME11357 Pestalotiopsis microspora
M3ANL0 1.78e-07 54 33 3 99 2 MYCFIDRAFT_190111 Atrochrysone carboxyl ACP thioesterase MYCFIDRAFT_190111 Pseudocercospora fijiensis (strain CIRAD86)
Q4WA58 1.9e-07 54 30 3 116 3 nscB Lactamase-like protein nscB Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A2I1C3U0 2.97e-07 53 31 4 122 1 nsrC Atrochrysone carboxyl ACP thioesterase nsrC Aspergillus novofumigatus (strain IBT 16806)
A0A067XMV3 4.64e-07 53 27 3 120 2 ptaB Lactamase-like protein ptaB Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q4WQZ6 5.74e-07 53 31 3 117 2 tpcB Atrochrysone carboxyl ACP thioesterase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A1D8J2 7.37e-07 52 29 4 118 3 nscB Lactamase-like protein nscB Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q5B0C9 8.53e-07 52 25 5 144 1 aptB Lactamase-like protein aptB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
E4V2N5 1.11e-06 52 26 4 126 3 nscB Lactamase-like protein nscB Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)
A0A7R7ZLL0 1.12e-06 52 28 4 118 3 AcTE Atrochrysone carboxyl ACP thioesterase Aspergillus chevalieri
G3KLH5 1.29e-06 52 31 4 119 1 adaB Lactamase-like protein adaB Aspergillus niger
A2QX23 1.29e-06 52 31 4 119 1 adaB Lactamase-like protein adaB Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
P37502 2.29e-06 50 27 9 184 3 yybB Probable metallo-hydrolase YybB Bacillus subtilis (strain 168)
Q0CCY4 5.11e-06 50 28 3 117 1 gedB Atrochrysone carboxyl ACP thioesterase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
M1WCF7 7.12e-06 49 31 3 102 2 CPUR_05436 Atrochrysone carboxyl ACP thioesterase CPUR_05436 Claviceps purpurea (strain 20.1)
Q5BH31 7.25e-06 49 26 6 158 3 mdpF Atrochrysone carboxyl ACP thioesterase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q1LZ83 1.71e-05 48 31 6 134 2 LACTB2 Endoribonuclease LACTB2 Bos taurus
F2S702 2.09e-05 48 27 4 122 3 nscB Lactamase-like protein nscB Trichophyton tonsurans (strain CBS 112818)
F2PWS8 2.09e-05 48 27 4 122 3 nscB Lactamase-like protein nscB Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
D4CZZ5 2.13e-05 48 31 3 99 3 nscB Lactamase-like protein nscB Trichophyton verrucosum (strain HKI 0517)
Q95Q18 2.17e-05 48 28 5 116 3 Y53F4B.39 Beta-lactamase-like protein 2 homolog Caenorhabditis elegans
A0A1L9WLF1 2.22e-05 48 28 2 97 1 AacuM Atrochrysone carboxyl ACP thioesterase AacuM Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q0V9A9 3.44e-05 47 31 6 135 2 lactb2 Endoribonuclease LACTB2 Xenopus tropicalis
Q5XGR8 5.46e-05 47 32 4 116 2 lactb2 Endoribonuclease LACTB2 Xenopus laevis
Q561R9 8.14e-05 46 27 6 140 2 Lactb2 Endoribonuclease LACTB2 Rattus norvegicus
Q4W945 0.000128 46 27 3 102 1 encB Atrochrysone carboxyl ACP thioesterase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q58298 0.000178 45 24 8 174 3 MJ0888 Probable metallo-hydrolase MJ0888 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A0A411PQM3 0.000379 44 25 2 105 3 AgnL7 Atrochrysone carboxyl ACP thioesterase AgnL7 Paecilomyces divaricatus
F2T0M3 0.000876 43 30 3 89 3 nscB Lactamase-like protein nscB Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
Q53H82 0.001 43 29 6 134 1 LACTB2 Endoribonuclease LACTB2 Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12810
Feature type CDS
Gene gloB
Product hydroxyacylglutathione hydrolase
Location 161484 - 162239 (strand: 1)
Length 756 (nucleotides) / 251 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1867
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00753 Metallo-beta-lactamase superfamily
PF16123 Hydroxyacylglutathione hydrolase C-terminus

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0491 General function prediction only (R) R Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01069 hydroxyacylglutathione hydrolase [EC:3.1.2.6] Pyruvate metabolism
Metabolic pathways		 -

Protein Sequence

MELIRISALSDNYIWLLRDNAHTCVIVDPGVSAPVLTALQKHGLTPAAILLTHHHADHTGGVTDLLSHYPDLPVYGPEETRTKGANHCVKDNDIITCGEFVFRVIAVPGHTLGHVAYYCAPYLFCGDTLFSGGCGRIFEGTAAQMYHSVTRLAALPDETLICCAHEYTQSNIAFARAIWPENDIIQAYQTHVAQLRQNNDATVPVTLETEKKINVFLNCDDLDLQHNLSAGKHTMTPEQTFAAIRVKKDKF

Flanking regions ( +/- flanking 50bp)

GAAAACATGGCGTTATCCTTAAATTATACCCGACTAAAGGTGAGGTATGTATGGAGCTTATCAGAATTTCCGCGTTATCGGATAACTACATTTGGCTATTACGCGATAATGCGCACACCTGCGTAATTGTCGATCCCGGCGTGAGTGCCCCCGTCCTGACAGCACTGCAAAAGCACGGATTAACGCCCGCTGCAATCCTGCTGACCCACCACCACGCTGACCATACCGGAGGAGTGACGGATCTTTTATCACATTATCCGGATTTACCGGTATACGGCCCGGAAGAAACACGGACTAAAGGGGCAAATCATTGCGTAAAAGACAATGACATTATCACCTGTGGCGAATTTGTTTTCCGGGTTATCGCCGTTCCGGGACACACGCTTGGTCACGTAGCTTATTATTGCGCACCCTATCTGTTTTGTGGCGACACCCTTTTCTCCGGCGGCTGCGGGCGGATTTTTGAAGGAACAGCAGCGCAGATGTATCACTCGGTTACCCGCCTCGCCGCTTTGCCGGATGAAACCCTGATATGCTGCGCGCATGAATATACACAATCCAATATCGCCTTTGCCCGCGCCATCTGGCCCGAAAATGATATAATTCAGGCATATCAGACGCATGTTGCACAATTACGTCAGAATAATGACGCTACTGTGCCTGTCACGCTGGAAACGGAAAAGAAAATTAATGTTTTTCTTAACTGTGATGACCTTGATCTGCAACATAATTTATCCGCAGGTAAACATACTATGACACCTGAGCAGACTTTTGCCGCAATACGTGTAAAAAAGGATAAATTTTAGCCGAAGACGTTGTCAGGGCGGAGCAACCCCCGTATGATTGCTGAACTTAA