Homologs in group_298

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07855 FBDBKF_07855 63.7 Morganella morganii S1 cdsB L-cysteine desulfidase YhaM
EHELCC_13685 EHELCC_13685 63.7 Morganella morganii S2 cdsB L-cysteine desulfidase YhaM
NLDBIP_14130 NLDBIP_14130 63.7 Morganella morganii S4 cdsB L-cysteine desulfidase YhaM
LHKJJB_08720 LHKJJB_08720 63.7 Morganella morganii S3 cdsB L-cysteine desulfidase YhaM
HKOGLL_08270 HKOGLL_08270 63.7 Morganella morganii S5 cdsB L-cysteine desulfidase YhaM
F4V73_RS13175 F4V73_RS13175 64.4 Morganella psychrotolerans - L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha
PMI_RS13525 PMI_RS13525 59.3 Proteus mirabilis HI4320 - L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha

Distribution of the homologs in the orthogroup group_298

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_298

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JIY2 8.19e-179 509 63 2 430 3 YE0448 UPF0597 protein YE0448 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9MPR6 3.98e-176 502 62 2 437 3 yhaM UPF0597 protein YhaM Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5REJ4 4.35e-176 502 62 2 437 3 yhaM UPF0597 protein YhaM Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZR6 1.8e-175 501 62 2 437 3 yhaM UPF0597 protein YhaM Salmonella enteritidis PT4 (strain P125109)
B5FHX2 1.8e-175 501 62 2 437 3 yhaM UPF0597 protein YhaM Salmonella dublin (strain CT_02021853)
Q8ZLW5 1.96e-175 501 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TIW6 1.96e-175 501 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella heidelberg (strain SL476)
Q3YXB9 2.81e-175 500 63 2 433 3 yhaM UPF0597 protein YhaM Shigella sonnei (strain Ss046)
B4T6A7 3.7e-175 500 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella newport (strain SL254)
B5F6P5 3.7e-175 500 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella agona (strain SL483)
B7M017 1.2e-174 498 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O8 (strain IAI1)
A7ZS00 1.2e-174 498 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O139:H28 (strain E24377A / ETEC)
B7UJ14 1.34e-174 498 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O127:H6 (strain E2348/69 / EPEC)
C0PZ11 1.43e-174 498 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella paratyphi C (strain RKS4594)
B4TVX2 2.03e-174 498 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella schwarzengrund (strain CVM19633)
Q8Z3K8 3.07e-174 498 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella typhi
B1LFL2 3.82e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli (strain SMS-3-5 / SECEC)
B7ND98 3.82e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FDC6 3.82e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7LH44 3.87e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli (strain 55989 / EAEC)
Q57JM2 4.41e-174 497 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella choleraesuis (strain SC-B67)
Q1R6M3 4.41e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli (strain UTI89 / UPEC)
Q0TCZ4 4.41e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AG22 4.41e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O1:K1 / APEC
B7N0B1 4.41e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O81 (strain ED1a)
B7MB40 4.41e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O45:K1 (strain S88 / ExPEC)
B5YS00 5.19e-174 497 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAF6 5.19e-174 497 63 2 433 2 yhaM UPF0597 protein YhaM Escherichia coli O157:H7
B6I485 7.45e-174 496 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli (strain SE11)
A9N623 8.96e-174 496 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
P42626 1.01e-173 496 63 2 433 2 yhaM UPF0597 protein YhaM Escherichia coli (strain K12)
B1XGS5 1.01e-173 496 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli (strain K12 / DH10B)
C4ZR24 1.01e-173 496 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli (strain K12 / MC4100 / BW2952)
Q83JI4 1.19e-173 496 63 2 433 3 yhaM UPF0597 protein YhaM Shigella flexneri
Q0T0F8 1.19e-173 496 63 2 433 3 yhaM UPF0597 protein YhaM Shigella flexneri serotype 5b (strain 8401)
Q31WS0 1.19e-173 496 63 3 434 3 yhaM UPF0597 protein YhaM Shigella boydii serotype 4 (strain Sb227)
B1IRK5 1.43e-173 496 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A4S3 1.43e-173 496 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O9:H4 (strain HS)
B7NJX7 1.43e-173 496 63 2 433 3 yhaM UPF0597 protein YhaM Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5BGF2 3.01e-173 495 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella paratyphi A (strain AKU_12601)
Q5PCB2 3.01e-173 495 61 2 437 3 yhaM UPF0597 protein YhaM Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B2U0A8 1.55e-172 493 63 3 434 3 yhaM UPF0597 protein YhaM Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A8AQ02 6.27e-172 492 62 2 429 3 CKO_04510 UPF0597 protein CKO_04510 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32BK8 1.11e-170 488 62 2 433 3 yhaM UPF0597 protein YhaM Shigella dysenteriae serotype 1 (strain Sd197)
B0BRT1 5.1e-160 461 57 3 435 3 APJL_1638 UPF0597 protein APJL_1638 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A5EWR5 9.93e-159 458 54 3 435 3 DNO_0106 UPF0597 protein DNO_0106 Dichelobacter nodosus (strain VCS1703A)
A3N2Q3 1.25e-155 450 57 3 435 3 APL_1605 UPF0597 protein APL_1605 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7NX05 6.21e-155 448 57 3 435 3 CV_1824 UPF0597 protein CV_1824 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6LKM4 1.4e-144 422 54 2 430 3 PBPRB0240 UPF0597 protein PBPRB0240 Photobacterium profundum (strain SS9)
A8H0P9 4.65e-143 418 54 4 439 3 Spea_0809 UPF0597 protein Spea_0809 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TUD9 1.51e-140 412 53 5 443 3 Shal_0864 UPF0597 protein Shal_0864 Shewanella halifaxensis (strain HAW-EB4)
A0KQF1 2.89e-136 401 51 3 431 3 AHA_4077 UPF0597 protein AHA_4077 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SHQ9 4.07e-134 395 50 4 431 3 ASA_0240 UPF0597 protein ASA_0240 Aeromonas salmonicida (strain A449)
Q87MQ8 5.52e-128 379 48 4 429 3 VP2173 UPF0597 protein VP2173 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A6TGU0 4.92e-125 372 48 4 428 3 KPN78578_43500 UPF0597 protein KPN78578_43500 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MUE1 2e-124 370 48 4 429 3 VIBHAR_03081 UPF0597 protein VIBHAR_03081 Vibrio campbellii (strain ATCC BAA-1116)
Q8A606 5.25e-124 369 44 1 431 3 BT_2080 UPF0597 protein BT_2080 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64PR7 3.46e-120 360 43 2 430 3 BF3772 UPF0597 protein BF3772 Bacteroides fragilis (strain YCH46)
Q5L9H9 3.46e-120 360 43 2 430 3 BF3560 UPF0597 protein BF3560 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6L239 2.59e-117 352 43 2 425 3 BVU_2091 UPF0597 protein BVU_2091 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B5FAY4 7.85e-114 343 46 4 429 3 VFMJ11_0655 UPF0597 protein VFMJ11_0655 Aliivibrio fischeri (strain MJ11)
Q5E760 5.01e-113 341 46 4 429 3 VF_0641 UPF0597 protein VF_0641 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A0KZH8 1.74e-111 337 48 3 424 3 Shewana3_2972 UPF0597 protein Shewana3_2972 Shewanella sp. (strain ANA-3)
B8E8Y9 6.8e-111 336 47 4 432 3 Sbal223_1296 UPF0597 protein Sbal223_1296 Shewanella baltica (strain OS223)
A9KXT3 8e-111 335 47 4 432 3 Sbal195_3223 UPF0597 protein Sbal195_3223 Shewanella baltica (strain OS195)
A3D738 8e-111 335 47 4 432 3 Sbal_3070 UPF0597 protein Sbal_3070 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A6WQX2 8.72e-111 335 47 4 432 3 Shew185_3080 UPF0597 protein Shew185_3080 Shewanella baltica (strain OS185)
Q0HSP5 1.04e-110 335 48 4 432 3 Shewmr7_2876 UPF0597 protein Shewmr7_2876 Shewanella sp. (strain MR-7)
Q0HGF3 1.04e-110 335 48 4 432 3 Shewmr4_2793 UPF0597 protein Shewmr4_2793 Shewanella sp. (strain MR-4)
Q8EH28 1.81e-109 332 47 4 432 3 SO_1403 UPF0597 protein SO_1403 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q314N8 3.85e-109 332 43 3 431 3 Dde_0807 UPF0597 protein Dde_0807 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B1KQ25 9.59e-109 330 47 4 425 3 Swoo_4889 UPF0597 protein Swoo_4889 Shewanella woodyi (strain ATCC 51908 / MS32)
A0KIQ4 5e-108 328 48 4 429 3 AHA_1619 UPF0597 protein AHA_1619 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1RM77 1.66e-107 327 47 3 428 3 Sputw3181_2955 UPF0597 protein Sputw3181_2955 Shewanella sp. (strain W3-18-1)
A4Y4Q4 3.2e-107 326 47 3 428 3 Sputcn32_1209 UPF0597 protein Sputcn32_1209 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6LB29 4.5e-107 326 43 3 425 3 BDI_1130 UPF0597 protein BDI_1130 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B6EGZ9 4.84e-106 323 46 4 429 3 VSAL_I0741 UPF0597 protein VSAL_I0741 Aliivibrio salmonicida (strain LFI1238)
Q7MVW8 6.71e-105 321 41 0 430 3 PG_0909 UPF0597 protein PG_0909 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A8FWC1 1.21e-104 320 45 5 432 3 Ssed_2537 UPF0597 protein Ssed_2537 Shewanella sediminis (strain HAW-EB3)
A8MIF4 6.93e-94 292 38 4 425 3 Clos_2050 UPF0597 protein Clos_2050 Alkaliphilus oremlandii (strain OhILAs)
Q38ZC4 2.57e-90 283 42 4 430 3 LCA_0156 UPF0597 protein LCA_0156 Latilactobacillus sakei subsp. sakei (strain 23K)
B1INA3 8.4e-88 277 36 5 425 3 CLD_2616 UPF0597 protein CLD_2616 Clostridium botulinum (strain Okra / Type B1)
B1KUQ8 1.9e-87 276 36 4 417 3 CLK_1462 UPF0597 protein CLK_1462 Clostridium botulinum (strain Loch Maree / Type A3)
A7GEX3 6.76e-87 275 35 5 425 3 CLI_2075 UPF0597 protein CLI_2075 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A6TX17 1.12e-85 272 37 5 430 3 Amet_4665 UPF0597 protein Amet_4665 Alkaliphilus metalliredigens (strain QYMF)
A5I3D3 4.63e-82 262 34 5 425 3 CBO2008 UPF0597 protein CBO2008/CLC_1955 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FV66 4.63e-82 262 34 5 425 3 CLB_1949 UPF0597 protein CLB_1949 Clostridium botulinum (strain ATCC 19397 / Type A)
Q8REF9 1.03e-81 261 34 6 437 3 FN1147 UPF0597 protein FN1147 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q0SUU2 4.11e-81 259 37 3 431 3 CPR_0790 UPF0597 protein CPR_0790 Clostridium perfringens (strain SM101 / Type A)
Q8XM84 4.08e-80 257 36 3 431 3 CPE0806 UPF0597 protein CPE0806 Clostridium perfringens (strain 13 / Type A)
Q0TSY6 2.57e-79 254 36 3 431 3 CPF_0803 UPF0597 protein CPF_0803 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q891Q9 1.07e-77 250 34 4 423 3 CTC_02309 UPF0597 protein CTC_02309 Clostridium tetani (strain Massachusetts / E88)
Q17ZX7 5.2e-76 246 36 3 422 3 CD630_32320 UPF0597 protein CD630_32320 Clostridioides difficile (strain 630)
Q6AB88 3.39e-73 236 40 2 355 3 PPA0217 UPF0597 protein PPA0217 Cutibacterium acnes (strain DSM 16379 / KPA171202)
A9KNN3 5.04e-73 238 35 5 426 3 Cphy_1256 UPF0597 protein Cphy_1256 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B1IN59 1.48e-72 237 35 4 423 3 CLD_2660 UPF0597 protein CLD_2660 Clostridium botulinum (strain Okra / Type B1)
A7GES9 1.48e-72 237 35 4 423 3 CLI_2031 UPF0597 protein CLI_2031 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I389 1.48e-72 237 35 4 423 3 CBO1964 UPF0597 protein CBO1964/CLC_1909 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FV20 1.48e-72 237 35 4 423 3 CLB_1903 UPF0597 protein CLB_1903 Clostridium botulinum (strain ATCC 19397 / Type A)
B0S032 1.58e-72 237 34 5 422 3 FMG_0209 UPF0597 protein FMG_0209 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q8RCY6 1.88e-69 229 33 6 425 3 TTE0269 UPF0597 protein TTE0269 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q73KS3 5.31e-68 225 34 10 438 3 TDE_2144 UPF0597 protein TDE_2144 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B9L7K6 6.98e-66 219 34 10 426 3 NAMH_0191 UPF0597 protein NAMH_0191 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q6AQQ3 2.85e-64 216 34 5 426 3 DP0591 UPF0597 protein DP0591 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B8FNF7 5.96e-63 213 36 6 425 3 Dalk_4447 UPF0597 protein Dalk_4447 Desulfatibacillum aliphaticivorans
A7GE60 7.01e-63 212 33 8 429 3 CLI_1810 UPF0597 protein CLI_1810 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B2KCX0 9.17e-62 209 30 5 427 3 Emin_0811 UPF0597 protein Emin_0811 Elusimicrobium minutum (strain Pei191)
B1IM83 2.18e-61 208 32 8 429 3 CLD_2825 UPF0597 protein CLD_2825 Clostridium botulinum (strain Okra / Type B1)
C5CEY4 2.47e-61 208 32 7 427 3 Kole_0595 UPF0597 protein Kole_0595 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B0TX30 1.47e-60 206 31 7 425 3 Fphi_1065 UPF0597 protein Fphi_1065 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A5I2T7 3.2e-60 205 32 7 428 3 CBO1815 UPF0597 protein CBO1815/CLC_1757 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FUM5 3.2e-60 205 32 7 428 3 CLB_1750 UPF0597 protein CLB_1750 Clostridium botulinum (strain ATCC 19397 / Type A)
B1KSB9 7.3e-60 204 32 8 430 3 CLK_1197 UPF0597 protein CLK_1197 Clostridium botulinum (strain Loch Maree / Type A3)
Q0W4W4 3.32e-59 202 32 5 425 3 UNCMA_16400 UPF0597 protein UNCMA_16400 Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
B7ICK4 8.78e-59 201 31 7 411 3 THA_1286 UPF0597 protein THA_1286 Thermosipho africanus (strain TCF52B)
A6LLR7 8.08e-58 198 29 8 416 3 Tmel_1007 UPF0597 protein Tmel_1007 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q24YJ4 2.2e-56 195 31 8 443 3 DSY1109 UPF0597 protein DSY1109 Desulfitobacterium hafniense (strain Y51)
C0QFK8 4.81e-56 194 36 7 439 3 HRM2_02820 UPF0597 protein HRM2_02820 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q74CZ2 3.63e-51 181 32 6 430 3 GSU1527 UPF0597 protein GSU1527 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1VGE6 7.11e-51 181 32 6 437 3 Dvul_2496 UPF0597 protein Dvul_2496 Nitratidesulfovibrio vulgaris (strain DP4)
Q72EX8 7.34e-51 181 32 6 437 3 DVU_0440 UPF0597 protein DVU_0440 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B8DLR0 9.05e-51 181 33 7 439 3 DvMF_1488 UPF0597 protein DvMF_1488 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A7HMJ2 2.56e-41 154 26 8 431 3 Fnod_1278 UPF0597 protein Fnod_1278 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q2RIL2 1.29e-38 147 31 11 410 3 Moth_1414 UPF0597 protein Moth_1414 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q6LX84 4.09e-33 132 25 12 439 3 MMP1468 L-cysteine desulfidase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q58431 2.91e-32 129 26 12 434 1 MJ1025 L-cysteine desulfidase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A9A9J5 3.57e-32 129 25 11 428 3 MmarC6_1205 L-cysteine desulfidase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A4FW56 1.36e-31 127 26 13 433 3 MmarC5_0110 L-cysteine desulfidase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A6VH54 1.49e-29 122 24 12 437 3 MmarC7_0713 L-cysteine desulfidase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
P44904 1.23e-20 90 63 0 83 3 HI_0855 UPF0597 protein HI_0855 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QM46 5.65e-20 88 62 0 83 3 NTHI1023 UPF0597 protein NTHI1023 Haemophilus influenzae (strain 86-028NP)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00700
Feature type CDS
Gene -
Product L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha
Location 179588 - 180910 (strand: -1)
Length 1323 (nucleotides) / 440 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_298
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF03313 Serine dehydratase alpha chain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3681 Amino acid transport and metabolism (E) E L-cysteine desulfidase YhaM

Protein Sequence

MKEQLSSYWKILIEAVKQQVKPALGCTEPISLALAAATAARYLQHNITRISAEVSPNLMKNGMGVTVPGTGMVGLSIAASLGAVAGDSEAGLEVLKNATPEQVELSKNLLNSGIVCVSIKKACQEVLYSEVTVEDGENSATVIIAGDHTNIVKIIHNGQVVLDKLSSQSEQTALPCQIKQALTNTNTREIYQFITQAPVEEISFILQSAQLNDALSKEGLNNTYGLHIGQTLQRQQQRGLLAKDLLSEIMIRTSAASDARMGGAVLPAMSNSGSGNQGIAATMPVVVVAEYLQVSEEKMARALMLSHLLAIYIHHKFPALSALCAATTASMGAAGAIAWLMEERYEPMAMAISSMIGDISGVICDGASNSCAMKVSTGASAAYKAVLMALDDTCVTGNDGIVTHDVDMTIENLCALASRAMQHTDVQIIEIMEYKAVANG

Flanking regions ( +/- flanking 50bp)

ATTACAATATAACGCCTTGAATTATTAAACTATTTATTGGACATAATGCAATGAAAGAACAATTATCTTCCTACTGGAAAATATTAATTGAAGCTGTTAAGCAACAAGTGAAGCCAGCTTTAGGTTGTACCGAACCCATTTCACTTGCATTAGCTGCTGCCACTGCAGCTCGTTATCTGCAACATAATATCACCCGTATTAGCGCAGAGGTTTCTCCTAACTTAATGAAAAACGGAATGGGAGTGACTGTACCGGGCACGGGTATGGTGGGATTATCCATTGCGGCTAGTTTAGGGGCTGTTGCTGGAGATAGTGAAGCAGGTCTAGAAGTATTAAAAAATGCCACACCAGAACAAGTTGAGTTGAGTAAAAATCTATTAAATTCAGGCATAGTCTGCGTATCAATAAAAAAAGCCTGCCAAGAGGTGCTTTACTCTGAGGTTACCGTTGAAGATGGTGAAAACAGTGCCACCGTCATTATTGCAGGTGATCATACTAATATTGTTAAAATTATCCATAATGGTCAGGTGGTGCTTGATAAATTATCATCACAATCTGAACAAACGGCCTTACCTTGCCAAATTAAGCAAGCCTTAACCAACACTAACACACGAGAAATCTATCAGTTTATTACTCAAGCTCCTGTAGAAGAAATTTCTTTTATTTTGCAATCGGCGCAATTAAATGACGCATTATCAAAAGAAGGCTTGAACAATACTTACGGTTTGCATATTGGTCAAACCTTACAACGCCAGCAACAACGTGGCTTGTTAGCTAAAGATCTGCTTTCTGAAATTATGATCCGCACTTCAGCGGCTTCTGATGCACGTATGGGCGGTGCCGTACTCCCCGCCATGAGTAACTCAGGTTCAGGAAATCAAGGTATTGCAGCTACAATGCCTGTTGTGGTGGTTGCTGAATATTTACAGGTTAGTGAAGAAAAAATGGCAAGAGCATTAATGCTTTCACATTTATTAGCCATTTATATTCACCATAAATTCCCGGCACTTTCCGCACTATGTGCCGCAACAACCGCATCAATGGGAGCTGCTGGTGCTATTGCGTGGCTAATGGAAGAACGCTATGAACCCATGGCAATGGCAATTAGTAGTATGATTGGCGATATTAGTGGCGTGATTTGTGATGGCGCCTCTAACAGTTGTGCGATGAAAGTGTCGACAGGAGCAAGTGCCGCTTATAAAGCGGTATTAATGGCGCTAGATGATACCTGCGTGACGGGTAATGACGGCATTGTCACTCATGATGTTGATATGACAATCGAGAATCTTTGTGCATTAGCTAGTCGAGCAATGCAACATACTGATGTACAAATTATTGAAATTATGGAATATAAAGCTGTTGCTAACGGCTAATTAGTATAAAAAAAACACCCCATAATGGTTATTATGGGGTGAAACATAAG