Homologs in group_2267

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17435 FBDBKF_17435 81.2 Morganella morganii S1 phoB phosphate regulon transcriptional regulator PhoB
EHELCC_17330 EHELCC_17330 81.2 Morganella morganii S2 phoB phosphate regulon transcriptional regulator PhoB
NLDBIP_17865 NLDBIP_17865 81.2 Morganella morganii S4 phoB phosphate regulon transcriptional regulator PhoB
LHKJJB_17785 LHKJJB_17785 81.2 Morganella morganii S3 phoB phosphate regulon transcriptional regulator PhoB
HKOGLL_17795 HKOGLL_17795 81.2 Morganella morganii S5 phoB phosphate regulon transcriptional regulator PhoB
F4V73_RS16610 F4V73_RS16610 80.8 Morganella psychrotolerans phoB phosphate regulon transcriptional regulator PhoB

Distribution of the homologs in the orthogroup group_2267

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2267

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45605 9.31e-143 401 79 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P0AFJ5 9.41e-142 398 79 0 229 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 9.41e-142 398 79 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 1.04e-141 398 79 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P45607 1.15e-140 395 78 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P23620 4.35e-100 293 60 1 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45189 8.31e-80 241 52 2 227 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q52990 8.08e-70 216 47 0 227 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P39663 7.74e-61 194 45 4 236 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P35163 1.94e-59 190 43 3 231 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q7A0U4 1.05e-58 188 41 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 1.05e-58 188 41 3 237 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 1.05e-58 188 41 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 1.05e-58 188 41 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 1.05e-58 188 41 3 237 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 1.05e-58 188 41 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 1.05e-58 188 41 3 237 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 1.05e-58 188 41 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P32040 3.77e-57 184 44 5 234 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q4A160 2.21e-53 174 43 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A216 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 1.41e-52 172 42 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 1.41e-52 172 42 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 1.41e-52 172 42 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 1.41e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8CQK0 1.75e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 1.75e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A1TEL7 2.96e-52 171 40 2 226 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q4LAJ9 3.15e-52 171 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P37478 3.19e-52 171 43 4 230 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
P0C001 1.25e-50 167 39 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.25e-50 167 39 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.25e-50 167 39 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.25e-50 167 39 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.25e-50 167 39 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.25e-50 167 39 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.25e-50 167 39 2 220 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.25e-50 167 39 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P69228 2.08e-50 167 40 4 228 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 2.08e-50 167 40 4 228 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1B3X8 3.46e-50 166 40 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 3.46e-50 166 40 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 3.46e-50 166 40 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q9F868 1.02e-49 165 39 3 228 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1KHB7 1.46e-49 164 39 2 225 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 1.46e-49 164 39 2 225 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGM9 2.41e-49 164 39 2 225 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 2.41e-49 164 39 2 225 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 2.41e-49 164 39 2 225 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q742C1 3.62e-49 163 40 3 222 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 3.62e-49 163 40 3 222 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
A0R3I8 7.26e-49 162 39 2 225 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WGL9 8.81e-49 162 40 4 228 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 8.81e-49 162 40 4 228 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 8.81e-49 162 40 4 228 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P13792 1.26e-48 162 41 4 235 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
O78428 1.32e-48 162 39 4 231 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P28835 1.34e-48 162 39 4 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q9CD68 1.66e-48 162 38 2 222 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
A0A4P7TS68 4.14e-48 161 37 3 229 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 4.14e-48 161 37 3 229 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 4.14e-48 161 37 3 229 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 4.14e-48 161 37 3 229 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 4.14e-48 161 37 3 229 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 4.14e-48 161 37 3 229 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 4.14e-48 161 37 3 229 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 4.14e-48 161 37 3 229 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P94413 5.8e-48 160 39 5 227 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q4L6C6 7.16e-48 160 40 6 223 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
A0PWB4 1.25e-47 159 39 3 227 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q99U73 3.94e-47 157 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P51358 8.86e-47 157 39 4 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 1.4e-46 157 39 4 231 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
A0QTK2 8.64e-46 155 43 3 225 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8DPL7 1.82e-45 154 40 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 1.82e-45 154 40 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 1.82e-45 154 40 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P48259 2.28e-45 154 39 5 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
G3XCY6 2.3e-45 154 38 3 231 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZEP4 2.68e-45 154 38 3 235 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82EB1 7.2e-45 152 39 4 236 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q31S42 1.26e-44 152 36 3 228 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q93CB8 1.8e-44 151 42 3 225 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 1.86e-44 151 42 3 225 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 1.86e-44 151 42 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 1.86e-44 151 42 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CCJ2 2.21e-44 151 42 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P28257 6.36e-44 150 38 4 231 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P42244 6.26e-43 147 36 3 227 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
O34903 7.45e-43 147 36 3 222 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P21866 1.91e-42 146 35 3 223 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
L7N689 2.32e-42 147 38 4 222 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q49XM7 3.28e-42 145 38 2 220 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0ACZ8 3.73e-42 145 36 1 220 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 3.73e-42 145 36 1 220 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 3.73e-42 145 36 1 220 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
Q49ZT8 1.52e-41 144 36 2 219 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9TLQ4 1.57e-41 144 37 4 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P54884 3.89e-41 142 42 3 184 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
P94504 6.73e-41 142 36 4 226 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P76340 1.31e-40 141 34 2 224 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q07783 1.72e-40 141 35 3 238 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q06239 1.87e-40 141 36 5 232 3 vanR Regulatory protein VanR Enterococcus faecium
Q55890 1.93e-40 141 36 3 225 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4L8L9 3.11e-40 140 33 2 221 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
P44918 3.55e-40 140 35 4 232 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8CN92 5.5e-40 140 33 2 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLN2 6.26e-40 139 33 2 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CQ17 6.8e-40 139 38 5 228 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 6.8e-40 139 38 5 228 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P42421 9.1e-40 139 32 2 229 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q5HPC3 1.59e-39 138 39 6 224 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CP82 1.6e-39 138 39 6 224 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9ZHD3 2.03e-39 138 36 3 222 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q7A1J1 2.16e-39 138 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 2.16e-39 138 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 2.16e-39 138 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 2.16e-39 138 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 2.16e-39 138 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 2.16e-39 138 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 2.16e-39 138 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 2.16e-39 138 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 2.16e-39 138 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 2.16e-39 138 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P0A4I0 4.08e-39 137 36 2 225 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 4.08e-39 137 36 2 225 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
O69730 5.4e-39 137 38 3 221 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P54443 5.61e-39 137 37 6 234 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
Q9I4F9 7.33e-39 137 34 2 225 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7D9K0 7.48e-39 137 36 2 222 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 7.48e-39 137 36 2 222 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q04942 7.57e-39 137 36 3 222 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P9WGM1 9.29e-39 137 37 2 204 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 9.29e-39 137 37 2 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 9.29e-39 137 37 2 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P08368 1.1e-38 136 37 5 224 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q2YZ24 1.26e-38 136 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9I0I1 3.3e-38 135 31 4 225 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q50136 4.37e-38 135 37 2 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q02540 4.97e-38 135 33 1 225 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q44006 5.03e-38 135 36 2 220 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9KM23 8.43e-38 135 36 7 233 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0DMK7 8.69e-38 134 37 2 225 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 8.69e-38 134 37 2 225 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
P50350 1.52e-37 134 35 4 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q44929 1.78e-37 134 34 5 237 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
Q6GE73 2.38e-37 133 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q7A039 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 4.07e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q55933 7.55e-37 132 32 4 233 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A6QJK3 8.17e-37 131 33 2 221 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 8.17e-37 131 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
P50351 1.63e-36 131 35 3 237 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P31079 1.67e-36 131 34 4 230 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q47456 5.76e-36 129 35 2 226 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
A0A0H3GGB5 1.64e-35 128 38 5 229 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P0A9Q4 2.97e-35 128 34 5 232 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 2.97e-35 128 34 5 232 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 2.97e-35 128 34 5 232 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 2.97e-35 128 34 5 232 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q8DN02 3.14e-35 127 36 4 223 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 3.14e-35 127 36 4 223 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P0AE90 7.12e-35 127 39 6 230 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 7.12e-35 127 39 6 230 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 7.12e-35 127 39 6 230 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P45337 1.42e-34 125 34 3 220 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O06978 3.47e-34 125 33 5 229 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q9HV32 2.23e-33 122 32 3 220 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8GP20 3.05e-33 122 35 4 219 1 rssB Swarming motility regulation protein RssB Serratia marcescens
P9WGN1 3.42e-33 122 32 3 226 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 3.42e-33 122 32 3 226 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q83RR0 5.13e-33 122 32 2 225 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 5.13e-33 122 32 2 225 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23836 5.95e-33 121 32 2 225 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
P44895 7.03e-33 121 36 5 225 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8X738 2.01e-32 120 32 2 225 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q01473 2.27e-32 127 33 4 226 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 0.000105 46 22 1 128 3 rcaC Protein RcaC Microchaete diplosiphon
Q8Z7H2 6.62e-32 119 32 4 226 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q9HUI2 1.14e-31 119 31 5 240 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DM78 2.68e-31 117 32 4 226 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 2.68e-31 117 32 4 226 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 2.68e-31 117 32 4 226 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 2.68e-31 117 32 4 226 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 2.68e-31 117 32 4 226 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q47744 2.82e-31 117 30 3 225 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q6GJ11 7.63e-31 116 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q8CQ37 1.22e-30 115 28 2 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.22e-30 115 28 2 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O32192 1.38e-30 115 32 6 234 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q57QC3 1.46e-30 115 32 4 226 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P0CL17 2.19e-30 115 34 4 220 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 2.19e-30 115 34 4 220 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
A8Z181 8.4e-30 113 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 8.4e-30 113 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 8.4e-30 113 29 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 8.4e-30 113 29 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 8.4e-30 113 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
P58357 1.25e-29 113 33 7 235 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
Q7A1L2 1.97e-29 112 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 1.97e-29 112 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 1.97e-29 112 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 1.97e-29 112 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 1.97e-29 112 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 1.97e-29 112 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YSS2 2.06e-29 112 29 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q932F1 2.52e-29 112 29 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P38684 4.08e-29 112 32 5 234 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P0A4H8 1.16e-28 110 31 2 176 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.16e-28 110 31 2 176 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9AE24 1.87e-28 110 31 5 225 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q2FWH6 4.61e-28 109 30 5 229 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
P52076 5.31e-28 108 31 4 225 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q8XBS3 7.07e-28 108 31 4 225 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P0A4I2 1.15e-27 107 36 6 224 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 1.15e-27 107 36 6 224 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q70FH0 2.44e-27 107 31 4 223 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q9K621 3.57e-27 107 27 2 222 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q49VK3 4.64e-27 106 28 2 221 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L481 6.04e-27 106 27 2 222 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q8FZ93 4.12e-26 104 30 3 221 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 4.12e-26 104 30 3 221 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 4.12e-26 104 30 3 221 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 4.12e-26 104 30 3 221 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 4.12e-26 104 30 3 221 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 4.12e-26 104 30 3 221 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 4.12e-26 104 30 3 221 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 4.12e-26 104 30 3 221 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P36556 4.96e-26 103 29 4 224 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66795 4.98e-26 103 30 5 224 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 4.98e-26 103 30 5 224 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P30843 6.39e-26 103 31 4 224 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
A6WZ81 6.55e-26 103 30 3 221 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P13359 1.07e-25 103 32 6 231 3 virG Regulatory protein VirG Rhizobium rhizogenes
B8H358 1.92e-25 102 30 4 222 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.92e-25 102 30 4 222 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P33112 2.22e-25 102 34 3 222 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
O31432 2.25e-25 102 29 8 229 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
O24973 1.39e-24 100 32 4 225 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q04803 1.51e-24 101 33 3 222 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P62722 4.38e-24 99 32 6 231 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
P07545 4.91e-24 99 32 6 231 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P55701 6.41e-24 98 27 4 222 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q44444 8.45e-24 99 32 6 231 3 virG Regulatory protein VirG Rhizobium radiobacter
P52108 1.25e-23 97 29 5 237 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
Q07597 1.46e-22 94 29 6 235 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
O34951 1.57e-22 94 24 2 222 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
Q05943 9.76e-20 88 32 9 194 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P43501 2.97e-18 80 35 0 117 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8GZM2 3.21e-17 83 37 0 121 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
B8GZM2 5.55e-05 47 30 0 75 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 3.21e-17 83 37 0 121 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A5I5 5.55e-05 47 30 0 75 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q06065 4.29e-17 82 43 2 109 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P48359 6.45e-17 79 26 3 199 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P46384 9.77e-17 77 32 0 125 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P72781 3e-16 78 34 1 119 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q51455 4.53e-16 75 29 1 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KQD5 6.55e-16 74 31 1 121 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 6.55e-16 74 31 1 121 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
T2KMF4 1.11e-15 79 27 6 217 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
O25918 1.77e-15 75 26 5 226 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q8D0P1 4.62e-15 72 31 1 122 3 cheY Chemotaxis protein CheY Yersinia pestis
Q93P00 5.46e-15 72 31 1 122 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q9ZM64 9.34e-15 71 26 1 119 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q1XDE4 1.97e-14 72 28 2 155 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q54SP4 2e-14 75 36 2 117 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 9.06e-05 46 28 5 138 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q9HV27 4.21e-14 73 44 0 78 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AE69 4.4e-14 69 29 1 122 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 4.4e-14 69 29 1 122 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 4.4e-14 69 29 1 122 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q8FGP6 4.54e-14 69 29 1 122 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P71403 4.66e-14 69 26 1 119 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
P0A2D5 6.88e-14 69 28 1 122 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 6.88e-14 69 28 1 122 3 cheY Chemotaxis protein CheY Salmonella typhi
Q9FAD7 6.88e-14 69 29 1 122 3 cheY Chemotaxis protein CheY Enterobacter cloacae
E0X9C7 7.03e-14 73 36 1 117 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q8KIY1 7.72e-14 73 36 2 119 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q4UU85 1.31e-13 72 36 3 122 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P06628 1.45e-13 68 36 1 120 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
P24072 1.55e-13 68 33 3 123 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
A5W4E3 2.66e-13 72 35 1 117 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P40138 4.31e-13 70 36 2 123 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
A1W0A5 5.01e-13 67 31 2 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 5.01e-13 67 31 2 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 5.01e-13 67 31 2 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P96686 1.03e-12 68 33 2 120 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q04849 2.78e-12 68 33 2 115 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P51586 4.45e-12 64 34 0 113 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P41789 6.3e-12 67 29 1 146 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FW53 8.39e-12 63 30 2 123 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 8.39e-12 63 30 2 123 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 8.39e-12 63 30 2 123 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 8.39e-12 63 30 2 123 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 8.39e-12 63 30 2 123 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 8.39e-12 63 30 2 123 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 8.39e-12 63 30 2 123 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 8.39e-12 63 30 2 123 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
Q9KSB1 1.53e-11 66 48 1 78 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P23221 2.09e-11 64 30 4 132 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A6X580 2.4e-11 62 30 2 123 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8EQQ3 4.26e-11 63 33 3 127 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9WY30 7.15e-11 64 34 2 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0AFB8 8.8e-11 64 28 1 146 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 8.8e-11 64 28 1 146 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q86AT9 1.03e-10 64 35 2 119 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
P52942 1.35e-10 60 33 1 112 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q56312 2.58e-10 59 30 3 115 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7XQA6 2.7e-10 60 25 2 120 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
A2XYV5 2.72e-10 60 25 2 120 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
Q9I4N3 4.08e-10 62 24 4 193 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KM66 4.11e-10 62 30 1 117 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0R4K1 5.74e-10 58 30 1 120 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q0D3B6 7.22e-10 62 28 1 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
A2YQ93 7.29e-10 62 28 1 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q8L9Y3 8.87e-10 61 33 3 129 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
Q2HWH1 1.04e-09 58 23 1 121 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 1.04e-09 58 23 1 121 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
P30198 1.36e-09 59 25 3 153 4 epiQ Putative epidermin response regulator Staphylococcus epidermidis
Q54YZ9 1.52e-09 61 32 1 118 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
O05251 1.68e-09 59 35 3 105 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
P51343 2e-09 58 29 4 154 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
P0A4I4 2.02e-09 59 26 2 125 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 2.02e-09 59 26 2 125 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2KCH7 2.03e-09 57 26 1 121 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P48027 2.36e-09 60 28 2 159 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P26487 2.63e-09 58 29 4 121 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P52928 2.89e-09 59 27 2 118 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P9WGM3 4e-09 58 29 2 127 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 4e-09 58 29 2 127 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P03029 5.28e-09 58 31 1 110 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q9HWA4 5.67e-09 58 28 2 121 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1RJS1 7.25e-09 58 31 2 115 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
Q9F8D7 8.97e-09 58 33 1 118 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q6H468 1.55e-08 55 23 1 109 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 1.55e-08 55 23 1 109 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
Q4UL27 1.64e-08 57 31 2 115 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q88RJ6 1.68e-08 57 31 1 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O83639 1.7e-08 57 32 4 123 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
P45671 1.88e-08 57 31 1 127 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
A2XFB7 2.09e-08 57 29 1 121 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q10N34 2.13e-08 57 29 1 121 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
G7WMP8 2.19e-08 55 33 3 123 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
P23747 2.29e-08 57 31 1 109 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P94514 2.65e-08 56 26 4 132 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
P45365 2.83e-08 57 26 0 118 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
O25153 2.96e-08 57 27 1 115 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q88AQ2 3.32e-08 56 30 1 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q92HC2 3.87e-08 56 31 2 111 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q68WH4 4.06e-08 56 30 2 115 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P52929 4.33e-08 55 37 0 74 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P52932 4.45e-08 55 32 5 124 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
Q9ZCY9 5.52e-08 56 30 2 115 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
A7N6S2 6.16e-08 56 28 1 115 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q00934 6.71e-08 55 26 2 151 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4GZL0 9.61e-08 54 25 4 136 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. indica
P0AED6 9.94e-08 54 29 3 117 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 9.94e-08 54 29 3 117 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
P66797 1.16e-07 53 29 3 117 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 1.16e-07 53 29 3 117 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q6K9T0 1.32e-07 52 23 1 109 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 1.32e-07 52 23 1 109 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
Q2HWG4 1.98e-07 53 25 4 136 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. japonica
Q3LWR6 2.09e-07 53 29 4 127 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 2.09e-07 53 29 4 127 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 2.09e-07 53 29 4 127 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P42012 2.09e-07 53 31 0 85 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
Q67W50 2.38e-07 54 33 3 112 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
P44845 2.44e-07 53 24 7 218 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P14375 2.96e-07 53 25 6 232 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q93WK5 2.98e-07 53 27 1 121 1 APRR7 Two-component response regulator-like APRR7 Arabidopsis thaliana
Q2QXY3 3.61e-07 52 26 2 119 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. japonica
B8BLZ4 3.61e-07 52 26 2 119 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. indica
Q2RAP3 3.83e-07 52 27 2 118 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. japonica
Q4GZK2 3.83e-07 52 27 2 118 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. indica
P15940 4.38e-07 52 29 3 121 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P0A4H5 4.51e-07 50 28 2 105 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 4.51e-07 50 28 2 105 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P10958 4.66e-07 52 27 1 101 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
P0C5S5 4.72e-07 53 32 1 83 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 4.72e-07 53 32 1 83 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P18769 4.76e-07 53 30 0 102 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q4A010 4.84e-07 52 25 5 157 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P52934 4.89e-07 52 28 4 132 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q87MX7 5.52e-07 53 32 1 83 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KT84 5.64e-07 53 33 1 80 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P28787 6.29e-07 52 26 2 133 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q8X613 8.14e-07 52 25 6 232 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q55169 8.43e-07 50 29 2 124 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P96126 8.5e-07 50 28 4 127 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q0PVB3 8.61e-07 51 22 1 109 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
P06534 9.28e-07 52 29 0 82 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P26275 9.6e-07 51 25 6 172 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HU19 1.12e-06 52 25 2 122 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8L500 1.13e-06 52 26 1 123 1 APRR9 Two-component response regulator-like APRR9 Arabidopsis thaliana
P52941 1.15e-06 51 31 0 88 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q689G6 1.38e-06 52 28 1 114 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
Q7MM78 1.41e-06 52 33 1 80 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 1.41e-06 52 33 1 80 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q4L8V4 1.43e-06 51 31 4 134 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
P52938 1.47e-06 51 33 2 93 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q5SML5 1.47e-06 52 28 2 121 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 1.47e-06 52 28 2 121 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q5A599 1.54e-06 52 29 2 131 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8FUS8 1.58e-06 50 27 6 155 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 1.58e-06 50 27 6 155 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 1.58e-06 50 27 6 155 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 1.58e-06 50 27 6 155 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
O07528 1.59e-06 50 32 3 112 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q04848 1.69e-06 51 27 2 127 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q6H805 1.74e-06 51 28 2 121 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
A2X1N2 1.89e-06 51 28 2 121 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
O14002 2.23e-06 51 30 4 120 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8DVB7 2.44e-06 50 27 5 143 3 lytR Sensory transduction protein LytR Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A0A0H3MDW1 2.55e-06 50 28 2 140 1 chxR Atypical response regulator protein ChxR Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
P42508 3.8e-06 49 26 3 135 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
P52931 3.83e-06 49 33 2 74 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
Q8KR08 3.94e-06 49 27 5 146 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P0AEV3 4.16e-06 50 27 1 106 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 4.16e-06 50 27 1 106 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 4.16e-06 50 27 1 106 3 rssB Regulator of RpoS Escherichia coli O157:H7
A5VW00 4.61e-06 49 27 6 155 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P45709 5.11e-06 47 30 3 120 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
P0C5S3 6.07e-06 48 28 4 138 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
P52936 6.09e-06 49 25 2 134 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q814J1 6.44e-06 49 28 2 112 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P24908 6.5e-06 48 31 2 103 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8GVV6 6.61e-06 47 25 1 104 2 RR8 Two-component response regulator ORR8 Oryza sativa subsp. japonica
Q4GZK3 6.61e-06 47 25 1 104 2 RR8 Two-component response regulator ORR8 Oryza sativa subsp. indica
Q5V0B3 6.62e-06 49 29 5 133 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9APD9 6.72e-06 49 32 1 103 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
O82868 6.72e-06 48 25 2 132 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q9LKL2 6.86e-06 50 25 1 121 1 APRR1 Two-component response regulator-like APRR1 Arabidopsis thaliana
Q6GK51 7.01e-06 49 27 7 143 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
Q1IRH0 7.71e-06 49 28 6 149 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q9FXD6 8.13e-06 49 29 3 122 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
P25852 8.22e-06 49 33 1 103 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P10577 8.22e-06 49 27 1 110 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P09432 8.27e-06 49 25 1 116 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P52940 8.29e-06 49 26 2 128 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
P58253 8.47e-06 49 32 2 87 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8Z333 9.01e-06 49 33 1 103 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
A6UEL7 9.74e-06 48 28 4 138 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
P13632 1.02e-05 49 25 1 112 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q9AAK0 1.11e-05 48 33 3 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q81JL3 1.12e-05 48 28 2 112 3 lytT Sensory transduction protein LytT Bacillus anthracis
P62646 1.13e-05 48 29 4 127 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q97GZ3 1.19e-05 48 27 5 153 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9ZWS9 1.29e-05 48 26 1 82 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
P10576 1.31e-05 48 27 1 119 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q95PI2 1.35e-05 49 26 6 157 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
P0DMC5 1.42e-05 48 31 1 104 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
O82798 1.43e-05 48 30 0 59 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
O24864 1.51e-05 48 29 4 123 3 cheV1 Chemotaxis protein CheV1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9SXL4 1.65e-05 48 30 2 102 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
O87940 1.66e-05 47 27 4 122 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
Q2YV67 1.67e-05 48 28 7 133 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P10046 1.7e-05 48 25 1 113 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P60610 1.73e-05 48 28 7 133 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 1.73e-05 48 28 7 133 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 1.73e-05 48 28 7 133 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 1.73e-05 48 28 7 133 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 1.73e-05 48 28 7 133 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q4GZK4 1.76e-05 47 22 2 109 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. indica
Q8NYH3 1.88e-05 47 28 7 133 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 1.88e-05 47 28 7 133 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
Q9LYP5 1.94e-05 48 25 3 112 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
O80366 2.01e-05 47 24 2 123 1 ARR9 Two-component response regulator ARR9 Arabidopsis thaliana
P39486 2.18e-05 47 31 3 108 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P55184 2.37e-05 47 28 3 121 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
Q9KA55 2.6e-05 47 30 3 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0DMC6 2.69e-05 48 31 1 104 1 rcsC Sensor histidine kinase RcsC Escherichia coli
Q9C5U0 2.77e-05 48 27 4 133 1 AHK4 Histidine kinase 4 Arabidopsis thaliana
P43016 2.79e-05 48 29 1 77 3 hilA Transcriptional regulator HilA Salmonella typhi
P0DMI2 3.34e-05 47 30 5 138 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 3.34e-05 47 30 5 138 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O49397 3.45e-05 47 27 2 120 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
O32197 3.48e-05 47 29 3 117 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
Q9FPR6 3.89e-05 45 24 2 115 2 ARR17 Two-component response regulator ARR17 Arabidopsis thaliana
P95582 4.1e-05 46 27 4 133 3 gacA Response regulator GacA Pseudomonas viridiflava
Q2HWG1 4.13e-05 45 24 1 104 2 RR12 Two-component response regulator ORR12 Oryza sativa subsp. japonica
P96602 4.18e-05 46 26 4 113 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q9SHC2 4.21e-05 45 23 2 118 1 ARR16 Two-component response regulator ARR16 Arabidopsis thaliana
Q39T95 4.38e-05 47 32 3 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9K998 4.41e-05 46 29 4 125 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00250
Feature type CDS
Gene phoB
Product phosphate regulon transcriptional regulator PhoB
Location 78944 - 79633 (strand: 1)
Length 690 (nucleotides) / 229 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2267
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)		 TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07657 two-component system, OmpR family, phosphate regulon response regulator PhoB Two-component system -

Protein Sequence

MARRILVVEDETAIREMICFVLEQNGFQPIEAEDYDTALSFLIDPYPDLVLLDWMIPGGSGIQVIKQMKRENNTRDIPIIMLTAKGEEEDKVKGLETGADDYVIKPFSPKELVARVKAILRRLSPMSAEDVIEFNGLSLDPVSHRVTSQDKPIDMGPTEFKLLHFFMTHPERVYSREQLLNYVWGTNVYVEDRTVDVHIRRLRKAIEQDGHDRMIQTVRGTGYRFSARF

Flanking regions ( +/- flanking 50bp)

AGTGCCTCATAATCATTATGACCCTCTATATAAATAACACAGGATAGAGTATGGCAAGGCGTATTCTTGTTGTTGAAGATGAAACCGCAATTCGAGAGATGATCTGTTTTGTATTAGAGCAAAATGGTTTTCAGCCTATTGAAGCTGAGGACTATGATACTGCATTGAGTTTTCTGATTGACCCTTACCCTGATCTGGTTTTATTAGATTGGATGATCCCCGGAGGCTCGGGTATCCAAGTGATTAAACAGATGAAGCGTGAAAATAATACCCGTGATATTCCTATTATTATGCTAACAGCAAAAGGGGAAGAAGAAGATAAAGTCAAAGGTCTCGAAACAGGCGCAGATGACTATGTGATTAAACCTTTTTCGCCTAAAGAGCTGGTGGCTCGGGTAAAGGCTATTTTACGACGATTGTCACCGATGTCGGCAGAAGATGTGATTGAATTTAATGGATTAAGTCTTGATCCTGTTTCACATCGAGTTACCAGTCAAGATAAACCCATTGATATGGGGCCTACCGAATTTAAACTTCTCCACTTTTTTATGACCCATCCCGAACGTGTATATAGCCGAGAGCAGTTGCTAAACTATGTTTGGGGCACCAATGTTTATGTCGAAGATCGTACTGTCGATGTACATATTCGTCGATTGCGTAAAGCTATAGAGCAAGATGGCCATGACCGAATGATACAAACGGTACGAGGAACGGGATATCGTTTCTCTGCTCGATTTTGAGTTGATAAGGGAGTAATTAACTGGTGTTAGAACGACTCTCATGGAAAGCC