Homologs in group_2267

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17435 FBDBKF_17435 95.2 Morganella morganii S1 phoB phosphate regulon transcriptional regulator PhoB
EHELCC_17330 EHELCC_17330 95.2 Morganella morganii S2 phoB phosphate regulon transcriptional regulator PhoB
NLDBIP_17865 NLDBIP_17865 95.2 Morganella morganii S4 phoB phosphate regulon transcriptional regulator PhoB
LHKJJB_17785 LHKJJB_17785 95.2 Morganella morganii S3 phoB phosphate regulon transcriptional regulator PhoB
HKOGLL_17795 HKOGLL_17795 95.2 Morganella morganii S5 phoB phosphate regulon transcriptional regulator PhoB
PMI_RS00250 PMI_RS00250 80.8 Proteus mirabilis HI4320 phoB phosphate regulon transcriptional regulator PhoB

Distribution of the homologs in the orthogroup group_2267

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2267

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45606 4.93e-142 399 79 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 5.26e-142 399 79 0 229 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 5.26e-142 399 79 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45607 1.11e-141 398 78 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P45605 1.17e-141 398 79 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P23620 1.95e-95 281 57 1 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45189 1.3e-78 238 50 2 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q52990 7.28e-68 211 47 0 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P35163 1.06e-56 183 41 3 233 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P39663 1.49e-56 183 44 4 236 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P32040 4.94e-54 176 43 5 233 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q7A0U4 1.12e-52 172 39 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 1.12e-52 172 39 3 237 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 1.12e-52 172 39 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 1.12e-52 172 39 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 1.12e-52 172 39 3 237 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 1.12e-52 172 39 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 1.12e-52 172 39 3 237 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 1.12e-52 172 39 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P37478 1.58e-49 164 40 3 230 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q7A216 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 3.26e-49 164 40 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 3.26e-49 164 40 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 3.26e-49 164 40 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 3.26e-49 164 40 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4A160 3.59e-49 164 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CQK0 6.17e-49 163 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 6.17e-49 163 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4LAJ9 8.27e-49 162 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P69228 1.23e-48 162 40 4 226 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 1.23e-48 162 40 4 226 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P13792 5.64e-48 160 39 4 235 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P0C001 7.8e-48 159 38 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 7.8e-48 159 38 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 7.8e-48 159 38 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 7.8e-48 159 38 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 7.8e-48 159 38 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 7.8e-48 159 38 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 7.8e-48 159 38 3 220 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 7.8e-48 159 38 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P94413 1.04e-47 159 38 5 228 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
O78428 4.74e-46 156 38 4 231 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q4L6C6 7.27e-46 154 39 3 219 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
Q8DPL7 7.4e-46 155 37 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 7.4e-46 155 37 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 7.4e-46 155 37 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A1TEL7 1.8e-45 154 38 3 226 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1B3X8 5.15e-45 153 38 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 5.15e-45 153 38 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 5.15e-45 153 38 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
G3XCY6 5.27e-45 153 38 3 226 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
L7N689 6.21e-45 153 39 3 222 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL9 1.04e-44 152 36 3 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 1.04e-44 152 36 3 225 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 1.04e-44 152 36 3 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P28835 1.18e-44 152 37 4 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q9F868 3.91e-44 150 36 3 226 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1KHB7 4.37e-44 150 37 2 225 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 4.37e-44 150 37 2 225 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CD68 4.45e-44 150 36 2 222 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P9WGM9 8e-44 150 37 2 225 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 8e-44 150 37 2 225 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 8e-44 150 37 2 225 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q99U73 1.19e-43 149 38 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q742C1 1.3e-43 149 37 2 222 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.3e-43 149 37 2 222 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P51358 2.21e-43 149 37 4 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
A0R3I8 2.25e-43 149 37 3 225 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q1XDC9 3.37e-43 149 37 4 231 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q31S42 8.43e-43 147 38 3 228 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0PWB4 4.11e-42 145 37 3 227 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q9I0I1 1e-41 144 36 4 224 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A4P7TS68 1.43e-41 144 37 6 232 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 1.43e-41 144 37 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 1.43e-41 144 37 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 1.43e-41 144 37 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 1.43e-41 144 37 6 232 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 1.43e-41 144 37 6 232 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 1.43e-41 144 37 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 1.43e-41 144 37 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q9KM23 4.98e-41 143 37 4 226 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O34903 1.02e-40 142 35 2 221 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q49ZT8 1.22e-40 141 35 2 219 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q93CB8 1.5e-40 141 40 3 225 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 1.76e-40 141 40 3 225 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 1.76e-40 141 40 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 1.76e-40 141 40 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CCJ2 2.75e-40 140 40 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P42244 3.01e-40 140 34 3 226 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q49XM7 3.14e-40 140 38 3 220 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P48259 3.49e-40 140 36 5 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q5HPC3 5.12e-40 139 38 4 220 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q55890 5.37e-40 140 37 3 225 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8CN92 6.2e-40 139 34 2 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLN2 6.9e-40 139 34 2 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CP82 8.22e-40 139 38 4 220 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q06239 1.06e-39 139 34 5 232 3 vanR Regulatory protein VanR Enterococcus faecium
P28257 2.72e-39 139 35 4 231 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
A0QTK2 3.44e-39 138 39 3 225 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P21866 5.98e-39 137 34 3 223 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q07783 8.23e-39 137 36 4 241 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q9ZEP4 8.85e-39 137 36 4 233 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0ACZ8 1.26e-38 136 35 1 224 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 1.26e-38 136 35 1 224 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 1.26e-38 136 35 1 224 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
O69730 1.44e-38 136 38 3 221 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q4L8L9 1.63e-38 136 33 2 221 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
P9WGM1 1.7e-38 136 39 3 205 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 1.7e-38 136 39 3 205 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 1.7e-38 136 39 3 205 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q82EB1 1.75e-38 136 37 5 234 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P76340 2.55e-38 135 37 5 224 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q2YZ24 3.29e-38 135 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P94504 4.8e-38 135 34 4 226 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q7D9K0 5.93e-38 135 37 2 222 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 5.93e-38 135 37 2 222 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9I4F9 9.58e-38 134 33 2 225 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P08368 1.04e-37 134 35 3 221 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q8CQ17 1.16e-37 134 38 6 228 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 1.16e-37 134 38 6 228 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P54884 1.98e-37 132 38 3 196 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q50136 2.33e-37 133 38 3 205 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q6GE73 4.38e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q7A039 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 7.58e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q7A1J1 8.71e-37 131 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 8.71e-37 131 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 8.71e-37 131 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 8.71e-37 131 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 8.71e-37 131 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 8.71e-37 131 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 8.71e-37 131 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 8.71e-37 131 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 8.71e-37 131 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 8.71e-37 131 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P44918 1.34e-36 131 35 4 231 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q04942 1.42e-36 131 36 3 222 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0A4I0 1.72e-36 130 34 2 225 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.72e-36 130 34 2 225 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q9TLQ4 1.88e-36 131 34 4 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
A6QJK3 1.93e-36 130 33 2 221 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 1.93e-36 130 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
O06978 2.28e-36 130 32 3 230 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q9ZHD3 4.85e-36 129 35 3 226 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P50350 7.52e-36 129 35 4 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
P50351 9.98e-36 129 35 3 237 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9HV32 1.18e-35 128 36 3 220 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q44929 1.79e-35 129 32 4 237 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
Q44006 3.44e-35 127 36 2 220 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P54443 9.57e-35 126 34 6 232 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P44895 3.55e-34 125 37 5 225 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H3GGB5 6.74e-34 124 37 5 229 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P0AE90 9.29e-34 124 37 6 229 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 9.29e-34 124 37 6 229 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 9.29e-34 124 37 6 229 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P0A9Q4 1.23e-33 124 34 4 231 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 1.23e-33 124 34 4 231 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 1.23e-33 124 34 4 231 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 1.23e-33 124 34 4 231 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q83RR0 2.35e-33 122 31 2 225 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 2.35e-33 122 31 2 225 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q02540 2.44e-33 122 34 3 221 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P42421 2.79e-33 122 30 2 226 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
P23836 3.2e-33 122 31 2 225 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
O32192 4.13e-33 122 32 4 228 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q47456 4.33e-33 122 34 2 226 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q55933 6.21e-33 122 32 5 234 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0DMK7 7.88e-33 121 35 2 225 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 7.88e-33 121 35 2 225 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q8X738 8.84e-33 121 31 2 225 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P45337 9.25e-33 121 34 3 220 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31079 1.07e-32 121 33 6 231 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8DN02 1.08e-32 120 34 4 224 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 1.08e-32 120 34 4 224 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8Z7H2 1.67e-32 120 31 2 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q47744 3.99e-32 119 32 3 225 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
P0DM78 8.47e-32 119 31 2 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 8.47e-32 119 31 2 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 8.47e-32 119 31 2 225 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 8.47e-32 119 31 2 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 8.47e-32 119 31 2 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8GP20 1.51e-31 118 33 4 219 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q57QC3 4.43e-31 117 31 2 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P9WGN1 4.76e-31 117 32 3 224 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 4.76e-31 117 32 3 224 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q01473 1.59e-30 121 38 5 180 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 4.98e-05 47 22 0 127 3 rcaC Protein RcaC Microchaete diplosiphon
Q9HUI2 3.62e-30 115 32 7 243 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6GJ11 1.11e-29 113 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q2FWH6 1.75e-29 113 30 3 228 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q4L481 2.34e-29 112 27 2 222 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
P52076 6.53e-29 111 36 6 222 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q8CQ37 6.84e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 6.84e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0CL17 7.06e-29 111 35 4 220 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 7.06e-29 111 35 4 220 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q7A1L2 7.61e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 7.61e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 7.61e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 7.61e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 7.61e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 7.61e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YSS2 7.77e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8XBS3 8.08e-29 110 36 6 222 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q932F1 8.11e-29 111 27 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9K621 1.14e-28 110 27 2 222 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8Z181 1.15e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 1.15e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 1.15e-28 110 27 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 1.15e-28 110 27 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 1.15e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
P58357 8.6e-28 108 32 6 231 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P0A4I2 1.51e-27 107 36 4 223 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 1.51e-27 107 36 4 223 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9AE24 1.66e-27 107 29 3 224 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q49VK3 1.98e-27 107 26 2 221 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P66795 9.33e-27 105 33 3 220 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 9.33e-27 105 33 3 220 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P38684 1.04e-26 105 31 6 231 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P0A4H8 1.09e-26 105 28 3 220 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.09e-26 105 28 3 220 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q70FH0 1.39e-26 105 31 4 223 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
P33112 3.23e-26 104 34 3 223 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
B8H358 1.26e-25 102 28 5 223 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.26e-25 102 28 5 223 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P36556 5.64e-25 100 31 4 220 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P30843 1.09e-24 100 32 6 225 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
A6WZ81 1.28e-24 100 28 5 223 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FZ93 1.67e-24 100 28 5 223 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.67e-24 100 28 5 223 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.67e-24 100 28 5 223 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.67e-24 100 28 5 223 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.67e-24 100 28 5 223 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.67e-24 100 28 5 223 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.67e-24 100 28 5 223 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.67e-24 100 28 5 223 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q04803 1.79e-23 99 34 5 223 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O34951 6.69e-23 95 23 2 222 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
O31432 2.19e-22 94 28 9 228 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P13359 6.31e-22 93 30 7 231 3 virG Regulatory protein VirG Rhizobium rhizogenes
O24973 1.34e-21 92 28 3 223 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
P55701 3.82e-21 90 29 2 176 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q07597 4.02e-21 90 27 7 245 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
P62722 1.21e-20 90 32 8 231 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
P07545 1.77e-20 89 31 8 232 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
Q44444 2.23e-20 89 32 8 231 3 virG Regulatory protein VirG Rhizobium radiobacter
Q05943 4.2e-19 86 40 4 131 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P52108 1.05e-18 84 28 5 237 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
O25918 4.82e-18 82 29 7 227 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P43501 4.66e-17 77 34 0 117 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P72781 4.87e-17 80 37 2 125 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P46384 5.48e-17 77 32 2 126 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8GZM2 1.46e-16 81 40 2 122 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
B8GZM2 2.94e-05 47 27 1 119 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 1.46e-16 81 40 2 122 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A5I5 2.94e-05 47 27 1 119 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
T2KMF4 1.81e-16 81 26 5 215 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q51455 1.92e-15 73 28 1 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q54SP4 2.2e-15 78 35 1 112 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q9KQD5 3.68e-15 72 31 1 121 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 3.68e-15 72 31 1 121 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P48359 6.84e-15 73 25 3 202 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
Q9HV27 1.22e-14 75 46 0 82 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8D0P1 4.88e-14 69 29 1 122 3 cheY Chemotaxis protein CheY Yersinia pestis
Q9ZM64 5.06e-14 69 25 1 119 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q8KIY1 7.16e-14 73 34 2 119 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q93P00 8.38e-14 68 29 1 122 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P71403 2.22e-13 67 24 1 119 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q1XDE4 2.47e-13 70 27 0 122 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P0AE69 9.03e-13 66 27 1 122 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 9.03e-13 66 27 1 122 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 9.03e-13 66 27 1 122 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q8FGP6 1.07e-12 66 27 1 122 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A2D5 1.23e-12 65 26 1 122 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 1.23e-12 65 26 1 122 3 cheY Chemotaxis protein CheY Salmonella typhi
E0X9C7 1.34e-12 70 29 4 183 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q04849 1.67e-12 69 33 2 115 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P24072 1.76e-12 65 31 3 122 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q9FAD7 3.09e-12 65 27 1 122 3 cheY Chemotaxis protein CheY Enterobacter cloacae
P06628 4.17e-12 64 35 1 120 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
A5W4E3 5.19e-12 68 28 4 183 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8FW53 7.49e-12 63 27 0 120 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 7.49e-12 63 27 0 120 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 7.49e-12 63 27 0 120 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 7.49e-12 63 27 0 120 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 7.49e-12 63 27 0 120 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 7.49e-12 63 27 0 120 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 7.49e-12 63 27 0 120 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 7.49e-12 63 27 0 120 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
P40138 1.02e-11 66 35 2 123 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
A6X580 1.29e-11 63 27 0 120 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P23221 2.28e-11 64 29 1 131 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A1W0A5 4.74e-11 61 24 1 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 4.74e-11 61 24 1 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 4.74e-11 61 24 1 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P51586 5.15e-11 61 31 0 123 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q9I4N3 8.92e-11 64 25 4 193 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q06065 9.14e-11 64 35 2 109 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P45365 3.48e-10 62 27 0 118 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
Q7XQA6 5.69e-10 59 27 2 120 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
Q4UU85 5.7e-10 61 39 0 74 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
A2XYV5 5.74e-10 59 27 2 120 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
Q2HWH1 1.19e-09 58 26 1 121 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 1.19e-09 58 26 1 121 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
P30198 1.46e-09 59 24 3 153 4 epiQ Putative epidermin response regulator Staphylococcus epidermidis
P51343 1.64e-09 59 40 0 64 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q56312 1.82e-09 57 30 3 115 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P41789 1.85e-09 60 29 1 136 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P96686 2.59e-09 58 30 3 120 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P52942 4.12e-09 56 32 1 112 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q54YZ9 9.26e-09 58 30 3 119 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q9KM66 1.19e-08 58 27 1 117 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1RJS1 1.74e-08 57 30 2 115 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
Q6H468 1.84e-08 55 26 1 109 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 1.84e-08 55 26 1 109 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
P0AFB8 2.76e-08 57 27 1 136 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.76e-08 57 27 1 136 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q9LKL2 2.9e-08 57 31 1 121 1 APRR1 Two-component response regulator-like APRR1 Arabidopsis thaliana
Q9WY30 3.89e-08 56 32 3 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O83639 4.44e-08 56 33 5 124 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q00934 4.8e-08 56 31 3 128 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B0R4K1 5.18e-08 53 29 1 120 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9F8D7 7.01e-08 55 32 3 119 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q4UL27 8.09e-08 55 30 2 115 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9KSB1 9.43e-08 55 32 2 119 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8EQQ3 1.05e-07 54 31 3 125 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0PVB3 1.13e-07 53 26 1 109 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
Q92HC2 1.88e-07 54 30 2 111 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O25153 2.14e-07 54 26 1 115 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
P42012 2.53e-07 53 30 0 85 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
Q30RX5 2.78e-07 53 31 4 132 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q68WH4 4.07e-07 53 27 2 115 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCY9 5.58e-07 53 27 2 115 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
P03029 5.61e-07 53 30 1 110 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P44845 5.9e-07 52 24 8 218 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6K9T0 5.98e-07 50 25 1 109 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 5.98e-07 50 25 1 109 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
P48027 6.01e-07 53 29 1 118 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q4GZL0 6.52e-07 52 28 4 132 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. indica
Q0D3B6 1.05e-06 52 27 1 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
A2YQ93 1.08e-06 52 27 1 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
P9WGM3 1.12e-06 51 29 2 127 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 1.12e-06 51 29 2 127 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8FUS8 1.12e-06 51 22 6 214 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 1.12e-06 51 22 6 214 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 1.12e-06 51 22 6 214 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 1.12e-06 51 22 6 214 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
P0A4I4 1.24e-06 51 24 2 125 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 1.24e-06 51 24 2 125 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2HWG4 1.46e-06 50 28 4 132 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. japonica
Q2RAP3 1.52e-06 50 26 2 118 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. japonica
Q4GZK2 1.52e-06 50 26 2 118 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. indica
P26487 1.74e-06 50 26 1 116 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q2KCH7 1.74e-06 49 23 1 118 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P94514 1.77e-06 50 25 3 128 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
P52928 1.89e-06 50 26 2 118 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
Q2QXY3 2.28e-06 50 26 2 118 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. japonica
B8BLZ4 2.28e-06 50 26 2 118 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. indica
Q67W50 2.34e-06 51 32 3 112 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
Q95PI2 2.4e-06 51 25 3 120 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
Q4GZK4 2.56e-06 50 26 2 109 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. indica
Q55169 2.61e-06 48 33 0 75 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9KT84 2.99e-06 50 31 1 83 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q52376 3.37e-06 49 28 5 157 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
Q689G9 3.38e-06 50 34 0 75 1 PRR1 Two-component response regulator-like PRR1 Oryza sativa subsp. japonica
A5VW00 3.47e-06 50 22 6 214 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P95582 3.47e-06 49 28 5 157 3 gacA Response regulator GacA Pseudomonas viridiflava
Q86AT9 3.52e-06 50 27 2 119 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
P23747 3.71e-06 50 31 1 109 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7MM78 3.83e-06 50 29 1 92 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 3.83e-06 50 29 1 92 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
O05251 4.07e-06 49 32 3 105 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q04848 4.58e-06 50 30 3 113 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A0A0H3MDW1 4.61e-06 49 27 2 148 1 chxR Atypical response regulator protein ChxR Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q88RJ6 4.8e-06 50 30 1 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O82868 4.84e-06 48 26 1 110 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
P18769 5.86e-06 50 28 0 102 1 frzE Gliding motility regulatory protein Myxococcus xanthus
G7WMP8 5.88e-06 48 35 0 74 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
Q9HWA4 6.02e-06 49 23 2 121 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4L8V4 6.36e-06 49 28 3 138 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q10N34 6.41e-06 50 27 1 121 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
A2XFB7 6.47e-06 50 27 1 121 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
P0C5S5 6.72e-06 49 28 1 89 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 6.72e-06 49 28 1 89 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P45671 6.88e-06 49 30 3 128 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q8L9Y3 7.13e-06 49 30 2 128 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
P10046 7.41e-06 49 26 1 113 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q87MX7 7.44e-06 49 28 1 89 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q88AQ2 7.54e-06 49 29 1 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8DET1 7.67e-06 48 28 5 139 3 VV1_0503 Uncharacterized response regulatory protein VV1_0503 Vibrio vulnificus (strain CMCP6)
P96126 8.03e-06 47 27 4 122 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q9HU19 8.53e-06 49 25 1 117 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52929 1.09e-05 48 30 1 107 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P10577 1.2e-05 48 30 3 111 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q9ZWS9 1.41e-05 48 29 1 82 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
Q5A599 1.42e-05 49 25 2 131 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
O14002 1.47e-05 49 30 4 120 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1MC14 1.5e-05 48 33 3 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P14375 1.9e-05 48 31 1 125 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
P52934 1.92e-05 48 25 4 131 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q7NSI8 2.63e-05 47 30 3 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P10958 2.98e-05 47 25 2 101 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
Q8L500 3.14e-05 47 25 1 123 1 APRR9 Two-component response regulator-like APRR9 Arabidopsis thaliana
Q8X613 3.16e-05 47 32 1 116 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q7A0I0 3.45e-05 47 26 3 136 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 3.45e-05 47 26 3 136 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 3.45e-05 47 26 3 136 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 3.45e-05 47 26 3 136 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 3.45e-05 47 26 3 136 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 3.45e-05 47 26 3 136 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9AAK0 3.6e-05 47 33 4 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O07528 3.63e-05 47 38 1 70 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P62646 3.74e-05 47 29 3 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q9APD9 3.98e-05 47 32 1 103 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P32967 4.07e-05 46 28 6 156 1 gacA Response regulator GacA Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q1IQS9 4.08e-05 47 29 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
P28787 4.16e-05 47 27 1 113 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q52883 4.18e-05 47 34 6 129 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q942A1 4.9e-05 46 28 1 83 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. japonica
Q4GZK7 4.9e-05 46 28 1 83 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. indica
Q87S86 5.24e-05 46 30 5 139 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9FAD8 5.32e-05 47 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Enterobacter cloacae
P06184 5.97e-05 47 27 3 108 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HUI3 6.43e-05 47 29 1 110 3 aruS Sensor histidine kinase AruS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1GZZ0 6.51e-05 46 31 4 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
P06534 6.68e-05 46 25 3 121 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
O82798 6.84e-05 46 32 0 59 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
Q9SB04 6.88e-05 45 32 0 59 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
Q9ZWS6 7.95e-05 45 30 0 59 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
O80366 8.01e-05 45 30 0 59 1 ARR9 Two-component response regulator ARR9 Arabidopsis thaliana
Q814J1 8.07e-05 46 27 3 112 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
O78417 8.78e-05 45 23 2 132 3 ycf29 Probable transcriptional regulator ycf29 Guillardia theta
P15940 8.94e-05 45 25 1 118 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q51373 9.09e-05 45 28 7 156 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AED6 9.53e-05 45 26 3 117 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 9.53e-05 45 26 3 117 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
P66797 9.62e-05 45 26 3 117 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 9.62e-05 45 26 3 117 3 uvrY Response regulator UvrY Escherichia coli O157:H7
P0A4H5 9.69e-05 44 26 3 107 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 9.69e-05 44 26 3 107 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q93WK5 9.69e-05 46 27 2 122 1 APRR7 Two-component response regulator-like APRR7 Arabidopsis thaliana
P52931 0.000102 45 28 5 122 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P23890 0.000102 46 32 2 89 1 cadC Transcriptional activator CadC Escherichia coli (strain K12)
Q5SML5 0.000105 46 27 2 121 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 0.000105 46 27 2 121 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
P52941 0.000117 45 30 0 88 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9SXL4 0.000118 46 25 5 155 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
Q689G6 0.000124 46 27 1 114 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
Q39KQ1 0.000133 45 32 4 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q63PS2 0.000139 45 32 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain K96243)
A2X1N2 0.00014 45 27 3 122 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q2STS8 0.00014 45 32 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P25852 0.000141 45 33 1 103 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6H805 0.000143 45 27 3 122 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
Q3JY65 0.000144 45 32 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain 1710b)
Q62G12 0.000144 45 32 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia mallei (strain ATCC 23344)
Q8Z333 0.000145 45 33 1 103 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P55184 0.000149 45 28 3 130 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
Q1BRL2 0.000149 45 32 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q81JL3 0.000155 45 27 3 112 3 lytT Sensory transduction protein LytT Bacillus anthracis
Q9SHC2 0.00016 44 28 0 59 1 ARR16 Two-component response regulator ARR16 Arabidopsis thaliana
Q9FPR6 0.000161 44 28 0 60 2 ARR17 Two-component response regulator ARR17 Arabidopsis thaliana
P0AEF7 0.000162 45 30 3 110 3 dpiA Transcriptional regulatory protein DpiA Shigella flexneri
P0AEF4 0.000162 45 30 3 110 1 dpiA Transcriptional regulatory protein DpiA Escherichia coli (strain K12)
P0AEF5 0.000162 45 30 3 110 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEF6 0.000162 45 30 3 110 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O157:H7
B8AEH1 0.000164 45 27 2 121 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q6K8X6 0.000167 45 27 2 121 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
A7N6S2 0.000173 45 24 1 115 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q221I1 0.000179 45 34 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q10WZ6 0.000218 45 27 4 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q13SY2 0.000257 45 32 4 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
Q1IRH0 0.000259 45 27 6 138 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q5GYV8 0.00027 44 30 4 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1V8 0.00027 44 30 4 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BUA2 0.000277 44 30 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLB4 0.000277 44 30 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q9KA55 0.000301 44 29 2 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2YV67 0.000315 44 23 10 225 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P13632 0.000324 44 25 2 113 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P10576 0.000364 44 29 4 133 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q3LWR6 0.000379 43 29 1 72 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 0.000379 43 29 1 72 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 0.000379 43 29 1 72 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P31908 0.000386 44 31 6 140 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16610
Feature type CDS
Gene phoB
Product phosphate regulon transcriptional regulator PhoB
Location 142358 - 143047 (strand: -1)
Length 690 (nucleotides) / 229 (amino acids)

Contig

Accession term accessions NZ_VXKB01000006 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2267
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)		 TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07657 two-component system, OmpR family, phosphate regulon response regulator PhoB Two-component system -

Protein Sequence

MARRILVVEDEAPIREMVCFVLEQNGYQPIEADDYDATIARLVEPFPDMVLLDWMIPGGTGIQIIKYMKRDNQLRDIPVMMLTARGEEEDRVKGLETGADDYLTKPFSPKELVARVKAILRRISPMAADDLIAMNGLTLDPASHRVTSNDNPLDMGPTEFKLLHFFMTHPERVYSREQLLNYVWGENVYVEDRTVDVHIRRLRKALETGGHDKMIQTVRGTGYRFSVRY

Flanking regions ( +/- flanking 50bp)

AATCGCGGCACTGTCTGATGAAATGAAATTAACGGTAAACAGGGGTAGTCATGGCAAGACGGATTTTAGTCGTTGAAGATGAAGCACCTATCCGTGAAATGGTCTGTTTTGTGCTGGAACAGAACGGGTATCAGCCAATTGAGGCTGATGATTATGACGCGACAATTGCCCGTCTGGTCGAGCCGTTTCCGGATATGGTGCTGCTTGACTGGATGATCCCGGGCGGCACCGGTATCCAGATTATCAAATATATGAAGCGTGATAATCAGCTGCGCGATATACCGGTAATGATGCTGACCGCCCGCGGAGAAGAGGAAGATCGCGTGAAGGGGCTGGAAACCGGCGCGGATGATTATCTGACTAAGCCGTTCTCACCAAAAGAGTTGGTTGCCAGGGTTAAAGCTATTCTCCGCCGTATTTCCCCGATGGCGGCAGATGATCTCATCGCTATGAACGGGCTGACACTCGATCCCGCCTCTCACCGCGTGACAAGTAATGATAATCCGCTGGATATGGGGCCGACAGAATTTAAATTGCTGCACTTTTTTATGACACACCCGGAGCGGGTTTACAGCCGGGAGCAATTGCTGAACTATGTCTGGGGTGAAAATGTTTATGTTGAGGATCGTACTGTGGATGTGCATATCCGCCGGTTGCGTAAGGCACTGGAAACAGGCGGTCACGACAAAATGATACAGACTGTCCGTGGTACGGGTTACCGTTTTTCCGTGCGTTACTGATTATAAACCGCAAGAGGATTGCGCGTGCTAGAGCGTCTTTCGTGGAAAAA