Homologs in group_1128

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06440 FBDBKF_06440 67.8 Morganella morganii S1 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
EHELCC_09485 EHELCC_09485 67.8 Morganella morganii S2 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
NLDBIP_09865 NLDBIP_09865 67.8 Morganella morganii S4 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
LHKJJB_07890 LHKJJB_07890 67.8 Morganella morganii S3 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
HKOGLL_07440 HKOGLL_07440 67.8 Morganella morganii S5 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
F4V73_RS15485 F4V73_RS15485 67.1 Morganella psychrotolerans fkpB FKBP-type peptidyl-prolyl cis-trans isomerase

Distribution of the homologs in the orthogroup group_1128

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1128

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEM3 1.36e-58 182 61 0 148 3 fkpB FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Shigella flexneri
P0AEM0 1.36e-58 182 61 0 148 1 fkpB FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Escherichia coli (strain K12)
P0AEM1 1.36e-58 182 61 0 148 3 fkpB FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEM2 1.36e-58 182 61 0 148 3 fkpB FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Escherichia coli O157:H7
P21863 1.12e-26 100 37 2 140 3 yaaD Probable FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Pseudomonas fluorescens
Q9KNX6 1.7e-14 70 36 4 142 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q57726 9.25e-11 60 29 3 145 3 MJ0278 Short-type peptidyl-prolyl cis-trans isomerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9CKP2 1.77e-10 60 31 4 141 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Pasteurella multocida (strain Pm70)
O52980 5.98e-10 57 30 2 112 1 None Short-type peptidyl-prolyl cis-trans isomerase Methanothermococcus thermolithotrophicus
O07046 1.83e-09 57 31 2 141 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Aeromonas hydrophila
P44830 3.17e-09 56 28 5 157 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A9L2 3.12e-08 53 29 4 142 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Shigella flexneri
P0A9K9 3.12e-08 53 29 4 142 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Escherichia coli (strain K12)
P0A9L0 3.12e-08 53 29 4 142 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9L1 3.12e-08 53 29 4 142 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Escherichia coli O157:H7
O83369 6.09e-08 52 29 5 155 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Treponema pallidum (strain Nichols)
Q58235 3.17e-07 51 31 4 111 1 MJ0825 Long-type peptidyl-prolyl cis-trans isomerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O27197 3.84e-07 51 33 3 106 1 MTH_1125 Long-type peptidyl-prolyl cis-trans isomerase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q7CFU4 1.3e-06 49 28 4 142 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Yersinia pestis
O25748 8.77e-05 44 22 1 134 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Helicobacter pylori (strain ATCC 700392 / 26695)
Q6CGG3 0.000348 42 31 0 67 3 FPR2 FK506-binding protein 2 Yarrowia lipolytica (strain CLIB 122 / E 150)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00085
Feature type CDS
Gene fkpB
Product FKBP-type peptidyl-prolyl cis-trans isomerase
Location 29232 - 29702 (strand: 1)
Length 471 (nucleotides) / 156 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1128
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00254 FKBP-type peptidyl-prolyl cis-trans isomerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1047 Posttranslational modification, protein turnover, chaperones (O) O Peptidyl-prolyl cis-trans isomerase, FKBP type

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03774 FKBP-type peptidyl-prolyl cis-trans isomerase SlpA [EC:5.2.1.8] - -

Protein Sequence

MSMQILNNSAVLLNFTLKLADGSVAESTQAHGKPALFRLGDESLSPALEAELVGLKEGEKKTFTLAGEHIFGKYNPDLIQYFMPSDFAQSGIPETGTIMLFTAMNGNEMPGIVQEVTEDSVTVDFNHPLALQDVTFDIEVVSIDPQEETTNANIAG

Flanking regions ( +/- flanking 50bp)

AAATAACCCCTGCCTAATGGCGGGGGTTACGCTTAATAGAAGGTATTAGTATGAGTATGCAGATCCTCAATAATAGTGCGGTATTGCTGAATTTCACCTTAAAATTGGCAGACGGCTCTGTTGCTGAATCTACACAAGCACATGGAAAACCAGCGTTATTTCGTCTTGGTGATGAAAGCTTATCGCCTGCTTTAGAAGCAGAGTTGGTAGGACTTAAAGAAGGGGAAAAGAAAACCTTCACGCTTGCGGGGGAGCATATTTTTGGTAAATATAATCCTGATCTTATTCAATACTTTATGCCTTCTGATTTTGCGCAATCCGGTATTCCTGAAACAGGTACCATTATGCTGTTTACGGCAATGAATGGTAATGAAATGCCAGGCATTGTGCAGGAAGTGACGGAAGATTCTGTTACTGTCGATTTTAATCATCCATTAGCGTTACAAGATGTCACATTTGATATTGAAGTCGTCAGTATTGATCCACAGGAGGAAACAACAAATGCAAATATTGCTGGCTAACCCACGAGGCTTTTGTGCGGGTGTTGACCGAGCTATCAGCATTGTTGAAC