Homologs in group_1128

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06440 FBDBKF_06440 100.0 Morganella morganii S1 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
EHELCC_09485 EHELCC_09485 100.0 Morganella morganii S2 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
NLDBIP_09865 NLDBIP_09865 100.0 Morganella morganii S4 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
LHKJJB_07890 LHKJJB_07890 100.0 Morganella morganii S3 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
F4V73_RS15485 F4V73_RS15485 80.4 Morganella psychrotolerans fkpB FKBP-type peptidyl-prolyl cis-trans isomerase
PMI_RS00085 PMI_RS00085 67.8 Proteus mirabilis HI4320 fkpB FKBP-type peptidyl-prolyl cis-trans isomerase

Distribution of the homologs in the orthogroup group_1128

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1128

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEM3 3.27e-58 180 61 0 139 3 fkpB FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Shigella flexneri
P0AEM0 3.27e-58 180 61 0 139 1 fkpB FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Escherichia coli (strain K12)
P0AEM1 3.27e-58 180 61 0 139 3 fkpB FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEM2 3.27e-58 180 61 0 139 3 fkpB FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Escherichia coli O157:H7
P21863 1.63e-28 105 36 2 142 3 yaaD Probable FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase Pseudomonas fluorescens
Q57726 1.08e-17 77 34 5 151 3 MJ0278 Short-type peptidyl-prolyl cis-trans isomerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O52980 3.29e-16 73 30 3 149 1 None Short-type peptidyl-prolyl cis-trans isomerase Methanothermococcus thermolithotrophicus
Q9KNX6 1.24e-11 62 34 4 149 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q58235 8.07e-11 60 31 3 112 1 MJ0825 Long-type peptidyl-prolyl cis-trans isomerase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O07046 2.73e-10 59 31 2 143 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Aeromonas hydrophila
O83369 1.44e-09 56 29 5 143 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Treponema pallidum (strain Nichols)
P0A9L2 5.41e-09 55 31 3 139 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Shigella flexneri
P0A9K9 5.41e-09 55 31 3 139 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Escherichia coli (strain K12)
P0A9L0 5.41e-09 55 31 3 139 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9L1 5.41e-09 55 31 3 139 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Escherichia coli O157:H7
O27197 1.27e-08 55 29 3 106 1 MTH_1125 Long-type peptidyl-prolyl cis-trans isomerase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q6CGG3 1.72e-08 53 39 0 64 3 FPR2 FK506-binding protein 2 Yarrowia lipolytica (strain CLIB 122 / E 150)
Q9CKP2 4.26e-08 53 28 3 139 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Pasteurella multocida (strain Pm70)
P44830 5.51e-08 52 29 4 144 3 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7CFU4 1.76e-07 51 30 3 139 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Yersinia pestis
Q32PA9 9.21e-07 48 37 0 61 2 FKBP2 Peptidyl-prolyl cis-trans isomerase FKBP2 Bos taurus
P26885 9.22e-07 48 37 0 61 1 FKBP2 Peptidyl-prolyl cis-trans isomerase FKBP2 Homo sapiens
P45878 1.07e-06 48 37 0 61 1 Fkbp2 Peptidyl-prolyl cis-trans isomerase FKBP2 Mus musculus
Q38936 1.81e-06 48 32 0 71 2 FKBP15-2 Peptidyl-prolyl cis-trans isomerase FKBP15-2 Arabidopsis thaliana
Q6BP84 7.01e-06 46 33 0 62 3 FPR2 FK506-binding protein 2 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q38935 7.19e-06 46 32 0 70 2 FKBP15-1 Peptidyl-prolyl cis-trans isomerase FKBP15-1 Arabidopsis thaliana
Q41649 2.27e-05 45 32 0 71 1 FKBP15 FK506-binding protein 2 Vicia faba
O22870 5.21e-05 44 33 0 63 1 FKBP16-3 Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic Arabidopsis thaliana
O25748 0.000113 43 23 2 139 1 slyD FKBP-type peptidyl-prolyl cis-trans isomerase SlyD Helicobacter pylori (strain ATCC 700392 / 26695)
Q9SCY2 0.000156 43 35 1 64 1 FKBP13 Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic Arabidopsis thaliana
Q6FSC1 0.000208 42 34 1 63 3 FPR2 FK506-binding protein 2 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q4WHX4 0.000226 42 35 0 54 3 fpr2 FK506-binding protein 2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WMV5 0.000281 43 32 1 65 3 fpr4 FK506-binding protein 4 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P32472 0.000314 41 30 1 69 1 FPR2 Peptidyl-prolyl cis-trans isomerase FPR2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6CUZ8 0.000357 41 33 2 78 3 FPR2 FK506-binding protein 2 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P0C1B0 0.000381 42 32 1 68 3 fpr4 FK506-binding protein 4 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5ATN7 0.000833 40 34 1 64 3 fkbB FK506-binding protein 2 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_07440
Feature type CDS
Gene fkpB
Product FKBP-type peptidyl-prolyl cis-trans isomerase
Location 89719 - 90150 (strand: 1)
Length 432 (nucleotides) / 143 (amino acids)

Contig

Accession ZDB_684
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1128
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00254 FKBP-type peptidyl-prolyl cis-trans isomerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1047 Posttranslational modification, protein turnover, chaperones (O) O Peptidyl-prolyl cis-trans isomerase, FKBP type

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03774 FKBP-type peptidyl-prolyl cis-trans isomerase SlpA [EC:5.2.1.8] - -

Protein Sequence

MQVAEHHSVLLDYTLKLSDGSVADSTEAQGKPALFRLGDGSLSDALEQQLLGLSAGDKKTFTLPGEAVFGKPSPDLIQFFSAADFLEAGLPETGTIMLFTAMNGSEMPGIIKSVTEDSVEVDFNHPLCGQDVTFDISVRDVTA

Flanking regions ( +/- flanking 50bp)

ATCCGCCGCCAGGCGGATATTTTTTATCTGATACAGAGAGTAATAATTATATGCAGGTTGCAGAACATCACAGCGTATTACTGGATTACACCCTGAAACTGTCTGACGGCTCGGTGGCGGATTCCACAGAAGCACAAGGCAAACCGGCACTGTTCCGCCTTGGCGACGGCAGCTTGTCTGATGCACTGGAGCAGCAATTGCTGGGCTTATCCGCCGGGGATAAAAAAACCTTCACACTGCCCGGTGAGGCGGTGTTCGGCAAACCGAGCCCGGATCTGATTCAGTTTTTCTCCGCCGCCGATTTCCTGGAAGCGGGTCTGCCGGAAACCGGCACGATCATGCTGTTTACCGCGATGAACGGCAGCGAAATGCCGGGAATTATCAAATCCGTTACTGAAGATTCTGTCGAGGTGGATTTCAACCATCCGTTGTGCGGACAGGATGTAACGTTTGATATCAGTGTCCGTGACGTCACGGCATAAGACACAGAGCAATAATTAGCATTACGGTCCGGGGGACGGCTCTGGTATAG