Homologs in group_3641

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20645 FBDBKF_20645 100.0 Morganella morganii S1 dfrA15 trimethoprim-resistant dihydrofolate reductase DfrA15
EHELCC_19890 EHELCC_19890 100.0 Morganella morganii S2 dfrA15 trimethoprim-resistant dihydrofolate reductase DfrA15
LHKJJB_19885 LHKJJB_19885 100.0 Morganella morganii S3 dfrA15 trimethoprim-resistant dihydrofolate reductase DfrA15
HKOGLL_19725 HKOGLL_19725 100.0 Morganella morganii S5 dfrA15 trimethoprim-resistant dihydrofolate reductase DfrA15

Distribution of the homologs in the orthogroup group_3641

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3641

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P78218 3.94e-114 322 100 0 157 3 dhfrXV Dihydrofolate reductase type 15 Escherichia coli
P00382 1.76e-105 300 91 0 157 1 dhfrI Dihydrofolate reductase type 1 Escherichia coli
P11731 7.39e-87 253 75 0 157 1 dhfrV Dihydrofolate reductase type 5 Escherichia coli
P27422 3.32e-82 242 71 0 157 3 dhfrVII Dihydrofolate reductase type 7 Escherichia coli
P95524 8.34e-73 218 63 0 157 3 dhfrVI Dihydrofolate reductase type 6 Proteus mirabilis
Q59408 4.53e-23 92 33 5 162 3 dfrA13 Dihydrofolate reductase type A13 Escherichia coli
P12833 1.86e-22 90 38 3 131 1 dhfrIII Dihydrofolate reductase type 3 Salmonella typhimurium
P00380 3.81e-21 87 34 3 158 1 folA Dihydrofolate reductase Enterococcus faecium
P0ABQ6 1.68e-20 85 33 5 160 3 folA Dihydrofolate reductase Shigella flexneri
P0ABQ4 1.68e-20 85 33 5 160 1 folA Dihydrofolate reductase Escherichia coli (strain K12)
P0ABQ5 1.68e-20 85 33 5 160 3 folA Dihydrofolate reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31074 2.21e-20 85 34 5 160 3 folA Dihydrofolate reductase Klebsiella aerogenes
P43791 5.96e-20 84 34 3 132 3 folA Dihydrofolate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31073 6.07e-20 84 33 5 160 3 folA Dihydrofolate reductase Citrobacter freundii
P0C0P1 6.79e-20 84 37 5 137 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB1 6.79e-20 84 37 5 137 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0C0P0 6.79e-20 84 37 5 137 1 folA Dihydrofolate reductase Staphylococcus epidermidis
P13955 1.05e-19 83 37 5 137 1 dfrA Dihydrofolate reductase type 1 from Tn4003 Staphylococcus aureus
P57243 4.8e-18 79 34 4 161 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P11045 6.53e-18 79 36 3 133 1 dfrA Dihydrofolate reductase Bacillus subtilis (strain 168)
Q59487 2.58e-17 77 35 2 125 3 folA Dihydrofolate reductase Lactococcus lactis subsp. lactis (strain IL1403)
Q27828 5.66e-17 80 37 7 157 3 GSPATT00019973001 Bifunctional dihydrofolate reductase-thymidylate synthase Paramecium tetraurelia
Q8K9Z8 1.64e-16 75 33 5 162 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0A017 5.62e-16 73 35 4 137 1 folA Dihydrofolate reductase Staphylococcus aureus
Q6GGY1 5.62e-16 73 35 4 137 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MRSA252)
P99079 5.62e-16 73 35 4 137 1 folA Dihydrofolate reductase Staphylococcus aureus (strain N315)
P0A016 5.62e-16 73 35 4 137 3 folA Dihydrofolate reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFZ7 5.62e-16 73 35 4 137 3 folA Dihydrofolate reductase Staphylococcus aureus (strain COL)
Q89AV2 6.75e-16 73 33 3 130 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q5V600 8.35e-16 73 32 1 136 3 folA2 Dihydrofolate reductase 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P28019 1.5e-15 73 30 6 181 3 DHFR Dihydrofolate reductase Aedes albopictus
P04174 2.54e-15 72 31 4 135 1 folA Dihydrofolate reductase Neisseria gonorrhoeae
Q54277 5.63e-15 71 33 4 131 1 dfrD Dihydrofolate reductase Staphylococcus haemolyticus
Q8NWQ9 7.12e-15 70 32 4 138 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MW2)
Q6G9D5 7.12e-15 70 32 4 138 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MSSA476)
Q54801 4.75e-14 68 31 2 131 1 dhfR Dihydrofolate reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9JSQ9 1.95e-13 67 30 3 134 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K168 2.14e-13 67 30 3 134 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P9WNX1 1.18e-12 65 30 6 163 1 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNX0 1.18e-12 65 30 6 163 3 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A547 1.18e-12 65 30 6 163 3 folA Dihydrofolate reductase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P78028 1.22e-12 65 33 4 127 3 folA Dihydrofolate reductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P15093 1.45e-11 62 32 4 135 1 hdrA Dihydrofolate reductase HdrA Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q59397 5.77e-11 60 30 3 130 3 dhfrIX Dihydrofolate reductase type 9 Escherichia coli
P17719 3.52e-10 58 26 7 180 1 Dhfr Dihydrofolate reductase Drosophila melanogaster
P47470 6.89e-10 57 28 3 142 3 folA Dihydrofolate reductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P00381 1.32e-09 57 26 3 159 1 folA Dihydrofolate reductase Lacticaseibacillus casei
P45350 2.03e-09 58 31 7 157 2 None Bifunctional dihydrofolate reductase-thymidylate synthase Daucus carota
Q9UWQ4 4.16e-09 56 27 3 147 1 hdrB Dihydrofolate reductase HdrB Haloferax volcanii
G4VJD6 4.45e-09 55 28 5 149 1 DHFR Dihydrofolate reductase Schistosoma mansoni
Q2QRX6 4.66e-09 57 31 7 147 3 Os12g0446900 Putative bifunctional dihydrofolate reductase-thymidylate synthase Oryza sativa subsp. japonica
P0ABQ8 5.2e-09 55 29 5 135 3 dhfrVIII Dihydrofolate reductase type 8 Shigella sonnei
P0ABQ7 5.2e-09 55 29 5 135 3 dhfrVIII Dihydrofolate reductase type 8 Escherichia coli
Q9CBW1 6.4e-09 55 26 5 159 3 folA Dihydrofolate reductase Mycobacterium leprae (strain TN)
Q05762 7.4e-09 56 28 5 159 1 THY-1 Bifunctional dihydrofolate reductase-thymidylate synthase 1 Arabidopsis thaliana
Q05763 3.88e-08 54 29 5 150 2 THY-2 Bifunctional dihydrofolate reductase-thymidylate synthase 2 Arabidopsis thaliana
Q9U8B8 8.65e-08 52 24 6 181 1 DHFR Dihydrofolate reductase Heliothis virescens
P51820 1.24e-07 53 28 8 175 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Glycine max
Q9PR30 1e-06 49 26 2 127 3 folA Dihydrofolate reductase Ureaplasma parvum serovar 3 (strain ATCC 700970)
P00377 1.47e-06 48 29 5 148 1 DHFR Dihydrofolate reductase Sus scrofa
P22906 2.52e-06 48 29 4 129 1 DFR1 Dihydrofolate reductase Candida albicans
Q98Q32 7.9e-06 47 26 2 131 3 folA Dihydrofolate reductase Mycoplasmopsis pulmonis (strain UAB CTIP)
P75478 1.11e-05 47 25 4 157 3 scpA Segregation and condensation protein A Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q5V3R2 2e-05 45 26 3 149 3 folA1 Dihydrofolate reductase 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P00376 2.94e-05 45 28 5 148 1 DHFR Dihydrofolate reductase Bos taurus
Q920D2 4.78e-05 45 27 5 148 1 Dhfr Dihydrofolate reductase Rattus norvegicus
P00375 7.68e-05 44 27 5 148 1 Dhfr Dihydrofolate reductase Mus musculus
P04753 7.99e-05 44 27 5 148 2 DHFR Dihydrofolate reductase Mesocricetus auratus
Q07801 0.000589 42 27 5 120 1 DFR1 Dihydrofolate reductase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P07807 0.000661 42 27 5 136 1 DFR1 Dihydrofolate reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_19925
Feature type CDS
Gene dfrA15
Product trimethoprim-resistant dihydrofolate reductase DfrA15
Location 145 - 618 (strand: 1)
Length 474 (nucleotides) / 157 (amino acids)

Contig

Accession ZDB_574
Length 833 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3641
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00186 Dihydrofolate reductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0262 Coenzyme transport and metabolism (H) H Dihydrofolate reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18589 dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3] One carbon pool by folate
Folate biosynthesis
Metabolic pathways
-

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
dfrA15 trimethoprim-resistant dihydrofolate reductase DfrA15 core AMR TRIMETHOPRIM TRIMETHOPRIM NF000330 

Protein Sequence

MKLSLMAAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSSDENVLVFPSIDEALNHLKTITDHVIVSGGGEIYKSLIDKVDTLHISTIDIEPEGDVYFPEIPSSFRPVFSQDFVSNINYSYQIWQKG

Flanking regions ( +/- flanking 50bp)

ACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAACCCCTAAGGAAGTATCGTGAAACTATCACTAATGGCAGCAATTTCGAAGAATGGAGTTATCGGAAATGGCCCAGATATTCCATGGAGTGCCAAAGGGGAACAATTACTCTTCAAAGCGATTACCTATAATCAGTGGCTTTTGGTAGGCCGAAAGACTTTCGAGTCAATGGGGGCTTTACCCAACCGAAAATATGCCGTTGTAACTCGTTCAAGCTTCACTTCCAGTGATGAGAATGTATTGGTATTTCCATCTATCGATGAAGCGCTAAATCATCTGAAGACGATAACGGATCATGTGATTGTGTCTGGTGGTGGTGAAATATACAAAAGCCTGATCGATAAAGTTGATACTTTACATATTTCAACAATCGACATTGAGCCAGAAGGTGATGTCTATTTTCCAGAAATCCCCAGTAGTTTTAGGCCAGTTTTTAGCCAAGACTTCGTGTCTAACATAAATTATAGTTACCAAATCTGGCAAAAGGGTTAACAAGTGGCAGCAACTGACCGCCAAAAGTGTCACTTGTTTTGCCAAAAAGC