Homologs in group_1678

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11715 FBDBKF_11715 100.0 Morganella morganii S1 - EfeO-type cupredoxin-like domain-containing protein
EHELCC_17635 EHELCC_17635 100.0 Morganella morganii S2 - EfeO-type cupredoxin-like domain-containing protein
LHKJJB_18075 LHKJJB_18075 100.0 Morganella morganii S3 - EfeO-type cupredoxin-like domain-containing protein
HKOGLL_19005 HKOGLL_19005 100.0 Morganella morganii S5 - EfeO-type cupredoxin-like domain-containing protein
F4V73_RS07980 F4V73_RS07980 89.2 Morganella psychrotolerans - cupredoxin domain-containing protein
PMI_RS00850 PMI_RS00850 73.6 Proteus mirabilis HI4320 - cupredoxin domain-containing protein

Distribution of the homologs in the orthogroup group_1678

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1678

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9ZDD7 6.68e-15 68 39 0 83 4 RP394 Uncharacterized protein RP394 Rickettsia prowazekii (strain Madrid E)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_19305
Feature type CDS
Gene -
Product EfeO-type cupredoxin-like domain-containing protein
Location 4839 - 5174 (strand: 1)
Length 336 (nucleotides) / 111 (amino acids)

Contig

Accession ZDB_547
Length 17998 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1678
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13473 Cupredoxin-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4633 General function prediction only (R) R Plastocyanin domain containing protein

Protein Sequence

MKLVVMALCLSVLSLISLPAAAAEKFTVELEMNNGELTPPVLKVPAKTPIRIKISNTGTEPVEFESTQLRKEKVLAPGASSVVVIAPLKPGKYTFFDDFHLSHPAGEIIAE

Flanking regions ( +/- flanking 50bp)

CGCGGTCTGCTGTCCGGACACCGGATGTCGCTATCCCGCTGAGGTCACTCATGAAACTCGTTGTTATGGCACTGTGTTTATCGGTGCTTTCCCTGATATCACTGCCCGCCGCAGCGGCAGAGAAATTCACTGTCGAACTGGAAATGAATAACGGCGAACTGACACCGCCGGTACTGAAGGTACCCGCGAAAACGCCGATCCGCATTAAAATCTCCAATACCGGCACCGAACCGGTCGAATTTGAAAGCACCCAGCTGCGCAAAGAGAAAGTGCTGGCTCCGGGGGCGTCTTCCGTGGTGGTGATTGCACCGCTCAAACCCGGAAAATATACCTTTTTTGATGATTTTCATCTGTCGCATCCGGCCGGTGAGATCATCGCGGAATAAGTGTCAGTTCACAGGAATTAATTATGGGACAGGTTCTTTTTGTCGTCTGG