Homologs in group_1721

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11715 FBDBKF_11715 89.2 Morganella morganii S1 - EfeO-type cupredoxin-like domain-containing protein
EHELCC_17635 EHELCC_17635 89.2 Morganella morganii S2 - EfeO-type cupredoxin-like domain-containing protein
NLDBIP_19305 NLDBIP_19305 89.2 Morganella morganii S4 - EfeO-type cupredoxin-like domain-containing protein
LHKJJB_18075 LHKJJB_18075 89.2 Morganella morganii S3 - EfeO-type cupredoxin-like domain-containing protein
HKOGLL_19005 HKOGLL_19005 89.2 Morganella morganii S5 - EfeO-type cupredoxin-like domain-containing protein
PMI_RS00850 PMI_RS00850 73.6 Proteus mirabilis HI4320 - cupredoxin domain-containing protein

Distribution of the homologs in the orthogroup group_1721

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1721

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9ZDD7 2.17e-14 67 32 0 108 4 RP394 Uncharacterized protein RP394 Rickettsia prowazekii (strain Madrid E)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07980
Feature type CDS
Gene -
Product cupredoxin domain-containing protein
Location 1664045 - 1664383 (strand: -1)
Length 339 (nucleotides) / 112 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1721
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13473 Cupredoxin-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4454 General function prediction only (R) R Uncharacterized copper-binding protein, cupredoxin-like subfamily

Protein Sequence

MKSLLIALCMTVLSLASLPVSAAAEKFTVELEMNNGVLTPPVLHVPAKTPVRIKIRNTGTEPVEFESTQLRKEKVLAPGASSVVVIAPLKPGKYTFFDDFHLSHPAGEIIAE

Flanking regions ( +/- flanking 50bp)

ATGCGCCTGCTGTTCTGACACCGGACGTCATTATCCCGCTGAGGTCACTCATGAAATCCCTTTTAATTGCACTGTGCATGACGGTGCTCTCTCTGGCATCTCTTCCCGTCAGTGCGGCGGCGGAGAAATTCACTGTTGAACTGGAAATGAATAACGGCGTACTGACGCCGCCGGTACTGCATGTTCCGGCGAAAACGCCTGTCCGCATTAAAATCCGTAATACCGGTACAGAGCCGGTTGAATTTGAAAGTACCCAGTTACGCAAAGAAAAAGTGCTGGCGCCCGGCGCATCTTCTGTGGTGGTCATTGCGCCGCTGAAACCCGGAAAATACACTTTTTTTGATGATTTTCACCTTTCGCATCCGGCCGGTGAGATCATCGCGGAATAAGTGTCAGGTCACAGGAATTGATTATGGGACAGGTTCTTTTTGTAGTATGG