Homologs in group_2411

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19140 FBDBKF_19140 100.0 Morganella morganii S1 rpmJ 50S ribosomal protein L36
EHELCC_18885 EHELCC_18885 100.0 Morganella morganii S2 rpmJ 50S ribosomal protein L36
LHKJJB_18755 LHKJJB_18755 100.0 Morganella morganii S3 rpmJ 50S ribosomal protein L36
HKOGLL_18490 HKOGLL_18490 100.0 Morganella morganii S5 rpmJ 50S ribosomal protein L36
F4V73_RS19025 F4V73_RS19025 100.0 Morganella psychrotolerans rpmJ 50S ribosomal protein L36
PMI_RS19140 PMI_RS19140 86.8 Proteus mirabilis HI4320 rpmJ 50S ribosomal protein L36

Distribution of the homologs in the orthogroup group_2411

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2411

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B2K516 4.87e-19 73 97 0 38 3 rpmJ2 Large ribosomal subunit protein bL36B Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A1JS06 4.87e-19 73 97 0 38 3 rpmJ2 Large ribosomal subunit protein bL36B Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NQP3 4.87e-19 73 97 0 38 3 rpmJ2 Large ribosomal subunit protein bL36B Sodalis glossinidius (strain morsitans)
B1JIY2 4.87e-19 73 97 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664U2 4.87e-19 73 97 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZJ91 4.87e-19 73 97 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Yersinia pestis
Q6CZZ1 4.87e-19 73 97 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4WFA7 8.53e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Enterobacter sp. (strain 638)
Q3YWW0 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36 Shigella sonnei (strain Ss046)
P0A7R0 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36 Shigella flexneri
Q0T003 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36 Shigella flexneri serotype 5b (strain 8401)
Q32B52 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VX7 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36 Shigella boydii serotype 4 (strain Sb227)
P0A7Q6 9.32e-19 72 94 0 38 1 rpmJ Large ribosomal subunit protein bL36A Escherichia coli (strain K12)
C4ZUF4 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36 Escherichia coli (strain K12 / MC4100 / BW2952)
P0A7Q7 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36 Escherichia coli O157:H7
P0A7Q8 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7Q9 9.32e-19 72 94 0 38 3 rpmJ Large ribosomal subunit protein bL36A Salmonella typhi
Q5PK05 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57J53 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Salmonella choleraesuis (strain SC-B67)
Q1R632 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Escherichia coli (strain UTI89 / UPEC)
B1LHB3 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Escherichia coli (strain SMS-3-5 / SECEC)
B1IQ00 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TCG2 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A5A4 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Escherichia coli O9:H4 (strain HS)
B1X6F1 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Escherichia coli (strain K12 / DH10B)
A7ZSI8 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MPF5 9.32e-19 72 94 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Cronobacter sakazakii (strain ATCC BAA-894)
C4K797 1.8e-18 72 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P61114 5.23e-18 70 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B1JAJ1 5.23e-18 70 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas putida (strain W619)
P61113 5.23e-18 70 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXR8 5.23e-18 70 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4XZ69 5.23e-18 70 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas mendocina (strain ymp)
C3K2V5 5.23e-18 70 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas fluorescens (strain SBW25)
Q48D57 5.23e-18 70 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4VHQ1 6.24e-18 70 89 0 38 3 rpmJ Large ribosomal subunit protein bL36 Stutzerimonas stutzeri (strain A1501)
Q1IFU5 6.96e-18 70 86 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudomonas entomophila (strain L48)
Q9HWF6 8.3e-18 70 86 0 38 1 rpmJ Large ribosomal subunit protein bL36A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T59 8.3e-18 70 86 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Pseudomonas aeruginosa (strain UCBPP-PA14)
A6UZK9 8.3e-18 70 86 0 38 3 rpmJ1 Large ribosomal subunit protein bL36A Pseudomonas aeruginosa (strain PA7)
Q1LTB7 1.13e-17 70 84 0 38 3 rpmJ Large ribosomal subunit protein bL36 Baumannia cicadellinicola subsp. Homalodisca coagulata
C1DKN4 2.02e-17 69 86 0 38 3 rpmJ Large ribosomal subunit protein bL36 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B4RT49 2.49e-17 69 84 0 38 3 rpmJ Large ribosomal subunit protein bL36 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q15X52 6.41e-17 68 81 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B4F1K5 7.99e-17 67 86 0 38 3 rpmJ Large ribosomal subunit protein bL36 Proteus mirabilis (strain HI4320)
Q21M37 9.42e-17 67 81 0 38 3 rpmJ Large ribosomal subunit protein bL36 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B3PK58 2.56e-16 66 81 0 38 3 rpmJ Large ribosomal subunit protein bL36 Cellvibrio japonicus (strain Ueda107)
Q89A86 2.56e-16 66 84 0 38 3 rpmJ Large ribosomal subunit protein bL36 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A4SSY5 4.55e-16 65 89 1 38 3 rpmJ2 Large ribosomal subunit protein bL36B Aeromonas salmonicida (strain A449)
Q46WG5 7.85e-16 65 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K641 7.85e-16 65 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LI59 7.85e-16 65 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1SXW4 1.15e-15 65 86 1 38 3 rpmJ1 Large ribosomal subunit protein bL36 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A3N378 1.15e-15 65 89 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BSV2 1.17e-15 65 89 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
P57942 1.2e-15 64 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Pasteurella multocida (strain Pm70)
P0A498 1.35e-15 64 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VLD6 1.35e-15 64 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Vibrio atlanticus (strain LGP32)
A5F559 1.35e-15 64 86 1 38 3 rpmJ2 Large ribosomal subunit protein bL36B Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0A497 1.35e-15 64 86 1 38 3 rpmJ Large ribosomal subunit protein bL36A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A7MWH9 1.35e-15 64 86 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Vibrio campbellii (strain ATCC BAA-1116)
Q13TJ2 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Paraburkholderia xenovorans (strain LB400)
B2T729 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B2JI43 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JAR2 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2SU49 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q33 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia pseudomallei (strain K96243)
A3NEF7 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia pseudomallei (strain 668)
Q3JMT5 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia pseudomallei (strain 1710b)
A3P091 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia pseudomallei (strain 1106a)
Q1BRX0 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia orbicola (strain AU 1054)
B1JU44 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia orbicola (strain MC0-3)
A1V881 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia mallei (strain SAVP1)
Q62GM7 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia mallei (strain ATCC 23344)
A2S7J8 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia mallei (strain NCTC 10229)
A3MRX6 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia mallei (strain NCTC 10247)
A9ADL5 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KE5 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ24 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5E2 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3P7 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia cenocepacia (strain HI2424)
B1YRQ1 1.77e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Burkholderia ambifaria (strain MC40-6)
B2UEJ7 2.07e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Ralstonia pickettii (strain 12J)
Q8XV34 2.07e-15 64 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7VKF4 2.45e-15 63 86 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0UX35 2.67e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Histophilus somni (strain 2336)
Q0I141 2.67e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Histophilus somni (strain 129Pt)
P46361 2.67e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDS6 2.67e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Haemophilus influenzae (strain PittEE)
Q057C5 2.69e-15 63 76 0 38 3 rpmJ Large ribosomal subunit protein bL36 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q493I8 3.14e-15 63 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Blochmanniella pennsylvanica (strain BPEN)
Q65QX6 3.48e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1RED5 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella sp. (strain W3-18-1)
Q0I084 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella sp. (strain MR-7)
Q0HNR6 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella sp. (strain MR-4)
A0KRP5 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella sp. (strain ANA-3)
B8CNF4 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella piezotolerans (strain WP3 / JCM 13877)
A4YBW2 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK49 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A3Q9A3 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q12ST8 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A6WHU9 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella baltica (strain OS185)
A3DA51 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBI4 4.73e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella baltica (strain OS223)
Q089N3 6.03e-15 63 89 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella frigidimarina (strain NCIMB 400)
B5EM95 6.03e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4A0 6.03e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B1KMW2 6.23e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella woodyi (strain ATCC 51908 / MS32)
A1S239 6.23e-15 63 86 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B5FGD7 7.67e-15 62 84 1 38 3 rpmJ Large ribosomal subunit protein bL36 Aliivibrio fischeri (strain MJ11)
Q5E893 7.67e-15 62 84 1 38 3 rpmJ Large ribosomal subunit protein bL36 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0V6U3 9.21e-15 62 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Acinetobacter baumannii (strain AYE)
A3M963 9.21e-15 62 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQT9 9.21e-15 62 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Acinetobacter baumannii (strain SDF)
B2HZ87 9.21e-15 62 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Acinetobacter baumannii (strain ACICU)
B7IA18 9.21e-15 62 73 0 38 1 rpmJ Large ribosomal subunit protein bL36 Acinetobacter baumannii (strain AB0057)
B7GW23 9.21e-15 62 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Acinetobacter baumannii (strain AB307-0294)
Q6F7T3 9.21e-15 62 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1AVM1 1.02e-14 62 84 1 38 3 rpmJ Large ribosomal subunit protein bL36 Ruthia magnifica subsp. Calyptogena magnifica
Q6LV95 1.37e-14 62 81 1 38 3 rpmJ Large ribosomal subunit protein bL36 Photobacterium profundum (strain SS9)
B8D828 1.92e-14 62 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57570 1.92e-14 62 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9S6 1.92e-14 62 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A6VLK9 2e-14 61 81 1 38 3 rpmJ Large ribosomal subunit protein bL36 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0VSI2 2.27e-14 61 76 0 38 3 rpmJ Large ribosomal subunit protein bL36 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q8K970 2.5e-14 61 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A5CXI5 2.57e-14 61 81 1 38 3 rpmJ Large ribosomal subunit protein bL36 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q2S933 2.89e-14 61 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Hahella chejuensis (strain KCTC 2396)
Q1R0F4 3.24e-14 61 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q488Z2 3.82e-14 61 81 1 38 3 rpmJ Large ribosomal subunit protein bL36 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5QXV4 4.5e-14 60 81 1 38 3 rpmJ Large ribosomal subunit protein bL36 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1TYL8 4.55e-14 60 78 1 38 3 rpmJ Large ribosomal subunit protein bL36 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8D1Z1 4.74e-14 60 76 0 38 3 rpmJ Large ribosomal subunit protein bL36 Wigglesworthia glossinidia brevipalpis
Q7VTA9 5.19e-14 60 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A9IHS2 5.19e-14 60 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7W2D3 5.19e-14 60 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRA1 5.19e-14 60 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2L250 5.19e-14 60 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bordetella avium (strain 197N)
A6W371 9.51e-14 60 81 1 38 3 rpmJ Large ribosomal subunit protein bL36 Marinomonas sp. (strain MWYL1)
Q6KI32 1.01e-13 60 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q046A3 1.3e-13 59 76 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B2SDW4 1.43e-13 59 78 1 38 3 rpmJ Large ribosomal subunit protein bL36 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q0ABF4 1.67e-13 59 81 1 38 3 rpmJ Large ribosomal subunit protein bL36 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1D752 1.77e-13 59 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Myxococcus xanthus (strain DK1622)
B2G8V5 2.3e-13 59 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLI2 2.3e-13 59 78 0 38 3 rpmJ Large ribosomal subunit protein bL36 Limosilactobacillus reuteri (strain DSM 20016)
Q9MUU8 2.52e-13 58 71 0 38 3 rpl36 Large ribosomal subunit protein bL36c Mesostigma viride
B4UBC2 2.6e-13 58 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Anaeromyxobacter sp. (strain K)
A7HBP1 2.6e-13 58 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Anaeromyxobacter sp. (strain Fw109-5)
Q2IJ62 2.6e-13 58 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J883 2.6e-13 58 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B5ZB63 2.73e-13 58 81 1 38 3 rpmJ Large ribosomal subunit protein bL36 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
A4IZR3 2.95e-13 58 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHU7 2.95e-13 58 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q4K4 2.95e-13 58 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Francisella tularensis subsp. novicida (strain U112)
Q2A5E9 2.95e-13 58 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Francisella tularensis subsp. holarctica (strain LVS)
Q14J99 2.95e-13 58 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Francisella tularensis subsp. tularensis (strain FSC 198)
B1Y8B5 3.8e-13 58 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
P56058 3.92e-13 58 78 1 38 3 rpmJ Large ribosomal subunit protein bL36 Helicobacter pylori (strain ATCC 700392 / 26695)
B8GV37 5.28e-13 58 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1WVA1 5.83e-13 58 78 1 38 3 rpmJ Large ribosomal subunit protein bL36 Halorhodospira halophila (strain DSM 244 / SL1)
Q7TU30 6.55e-13 58 68 0 38 3 rpmJ Large ribosomal subunit protein bL36 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A2BYR6 6.55e-13 58 68 0 38 3 rpmJ2 Large ribosomal subunit protein bL36B Prochlorococcus marinus (strain MIT 9515)
A6T3I2 6.72e-13 57 78 1 38 3 rpmJ Large ribosomal subunit protein bL36 Janthinobacterium sp. (strain Marseille)
A2SLD5 6.95e-13 57 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q21QP5 7.1e-13 57 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q12G81 9.35e-13 57 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VJ36 9.35e-13 57 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Polaromonas naphthalenivorans (strain CJ2)
Q04BZ2 9.52e-13 57 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBJ5 9.52e-13 57 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q5FM68 9.52e-13 57 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
C1DAT9 9.56e-13 57 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Laribacter hongkongensis (strain HLHK9)
Q5P311 1.13e-12 57 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1KB05 1.36e-12 57 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Azoarcus sp. (strain BH72)
Q74L67 1.53e-12 57 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B9LJF5 1.63e-12 57 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
B8G6Q2 1.63e-12 57 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Chloroflexus aggregans (strain MD-66 / DSM 9485)
A9WH89 1.63e-12 57 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q85FU5 1.69e-12 57 76 1 38 3 rpl36 Large ribosomal subunit protein bL36c Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P73300 2.05e-12 56 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4FUD5 2.73e-12 56 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B3PMM4 2.87e-12 56 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Metamycoplasma arthritidis (strain 158L3-1)
A5USG6 3.26e-12 56 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Roseiflexus sp. (strain RS-1)
Q9PQN7 3.31e-12 56 78 1 38 3 rpmJ Large ribosomal subunit protein bL36 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIP3 3.31e-12 56 78 1 38 3 rpmJ Large ribosomal subunit protein bL36 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
C4XLZ5 3.35e-12 56 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q035A6 3.68e-12 56 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAJ5 3.68e-12 56 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lacticaseibacillus casei (strain BL23)
Q1QDG5 4.01e-12 55 68 0 38 3 rpmJ Large ribosomal subunit protein bL36 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7V9Y2 4.29e-12 55 68 0 38 3 rpmJ Large ribosomal subunit protein bL36 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A9BCM7 4.29e-12 55 68 0 38 3 rpmJ Large ribosomal subunit protein bL36 Prochlorococcus marinus (strain MIT 9211)
B1XSS3 4.53e-12 55 73 0 38 3 rpmJ Large ribosomal subunit protein bL36 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
C1A4J4 4.89e-12 55 68 0 38 3 rpmJ Large ribosomal subunit protein bL36 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q4AAY2 4.91e-12 55 72 1 37 3 rpmJ Large ribosomal subunit protein bL36 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAZ1 4.91e-12 55 72 1 37 3 rpmJ Large ribosomal subunit protein bL36 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD10 4.91e-12 55 72 1 37 3 rpmJ Large ribosomal subunit protein bL36 Coxiella burnetii (strain Dugway 5J108-111)
B2UV60 4.91e-12 55 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Helicobacter pylori (strain Shi470)
Q9ZJT1 4.91e-12 55 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Helicobacter pylori (strain J99 / ATCC 700824)
Q1CRW3 4.91e-12 55 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Helicobacter pylori (strain HPAG1)
C5CQ79 5.67e-12 55 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Variovorax paradoxus (strain S110)
Q605D3 5.67e-12 55 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q03PY0 6.01e-12 55 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q04G63 6.93e-12 55 68 0 38 3 rpmJ Large ribosomal subunit protein bL36 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A9BFZ4 7.19e-12 55 76 0 38 3 rpmJ Large ribosomal subunit protein bL36 Petrotoga mobilis (strain DSM 10674 / SJ95)
Q03ED9 7.65e-12 55 71 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B3E853 8.42e-12 55 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q3ZZQ0 1e-11 55 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Dehalococcoides mccartyi (strain CBDB1)
A5FRW8 1e-11 55 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q3Z957 1e-11 55 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q2JL77 1.14e-11 54 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain JA-2-3B'a(2-13))
A7NR40 1.29e-11 54 68 0 38 3 rpmJ Large ribosomal subunit protein bL36 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q39XY3 1.41e-11 54 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q7VQC7 1.42e-11 54 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Blochmanniella floridana
Q1IS98 1.58e-11 54 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Koribacter versatilis (strain Ellin345)
Q01WB6 1.61e-11 54 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Solibacter usitatus (strain Ellin6076)
A6Q1K0 1.68e-11 54 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Nitratiruptor sp. (strain SB155-2)
A1W329 1.8e-11 54 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Acidovorax sp. (strain JS42)
B9MBV8 1.8e-11 54 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Acidovorax ebreus (strain TPSY)
Q2JQL3 1.81e-11 54 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain JA-3-3Ab)
A1TJT8 1.98e-11 54 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Paracidovorax citrulli (strain AAC00-1)
A6QCS0 2.07e-11 54 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Sulfurovum sp. (strain NBC37-1)
Q88XW3 2.25e-11 54 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C6E4N4 2.29e-11 53 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Geobacter sp. (strain M21)
B5EFS3 2.29e-11 53 76 1 38 3 rpmJ Large ribosomal subunit protein bL36 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q5WZJ1 2.31e-11 53 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Legionella pneumophila (strain Lens)
Q5ZYM2 2.31e-11 53 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X838 2.31e-11 53 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Legionella pneumophila (strain Paris)
Q38UT4 2.36e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Latilactobacillus sakei subsp. sakei (strain 23K)
Q47J81 2.82e-11 53 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Dechloromonas aromatica (strain RCB)
P52864 3.44e-11 53 71 1 38 1 rpmJ Large ribosomal subunit protein bL36 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
C1CPB1 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIC0 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pneumoniae (strain P1031)
C1CC29 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pneumoniae (strain JJA)
A3CK87 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus sanguinis (strain SK36)
P0A496 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A495 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1I8M1 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAN5 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pneumoniae (strain 70585)
A8AZK2 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q02W48 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNN0 3.58e-11 53 65 0 38 1 rpmJ Large ribosomal subunit protein bL36 Lactococcus lactis subsp. cremoris (strain MG1363)
P0A494 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactococcus lactis subsp. cremoris
P0A493 3.58e-11 53 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Lactococcus lactis subsp. lactis (strain IL1403)
A2CC48 3.75e-11 53 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Prochlorococcus marinus (strain MIT 9303)
Q30TS7 3.88e-11 53 73 1 38 3 rpmJ Large ribosomal subunit protein bL36 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7TUP2 3.88e-11 53 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Prochlorococcus marinus (strain MIT 9313)
P38015 4.62e-11 53 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycoplasma sp.
Q73PL1 5.11e-11 53 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q839E1 5.93e-11 53 65 0 38 1 rpmJ Large ribosomal subunit protein bL36 Enterococcus faecalis (strain ATCC 700802 / V583)
Q03ZM3 6.59e-11 53 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q0P3P7 6.87e-11 52 71 1 38 3 rpl36 Large ribosomal subunit protein bL36c Ostreococcus tauri
A8F4T5 7.23e-11 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A0L5Z4 9.66e-11 52 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B9KEH2 9.66e-11 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q5HSK0 9.66e-11 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Campylobacter jejuni (strain RM1221)
A1W1J3 9.66e-11 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PM84 9.66e-11 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FNQ3 9.66e-11 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q7NPQ7 9.87e-11 52 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3AW73 1.02e-10 52 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain CC9902)
Q7U4I0 1.02e-10 52 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Parasynechococcus marenigrum (strain WH8102)
Q9RSK0 1.08e-10 52 73 1 38 1 rpmJ Large ribosomal subunit protein bL36 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A5GVY0 1.14e-10 52 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain RCC307)
B2KEJ7 1.15e-10 52 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Elusimicrobium minutum (strain Pei191)
Q3AMQ0 1.16e-10 52 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain CC9605)
B9DSX3 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q03IH4 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2D6 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXT4 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus thermophilus (strain CNRZ 1066)
C0ME28 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus equi subsp. zooepidemicus (strain H70)
B5XJ59 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE51 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VS6 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC37 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8Z0 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ38 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JNZ4 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE36 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66305 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEB2 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE50 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66303 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus pyogenes serotype M1
P66308 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B4U523 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M6X5 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus equi subsp. equi (strain 4047)
P66307 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66306 1.21e-10 52 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Streptococcus agalactiae serotype III (strain NEM316)
Q72NI4 1.26e-10 52 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q055C1 1.26e-10 52 65 1 38 3 rpmJ1 Large ribosomal subunit protein bL36 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PW1 1.26e-10 52 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A0T0J7 1.37e-10 52 68 1 38 3 rpl36 Large ribosomal subunit protein bL36c Phaeodactylum tricornutum (strain CCAP 1055/1)
C1CXD8 1.57e-10 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A8ETK2 1.58e-10 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Aliarcobacter butzleri (strain RM4018)
Q250K8 1.6e-10 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Desulfitobacterium hafniense (strain Y51)
B8G1Z0 1.6e-10 52 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B0SA24 1.64e-10 52 70 1 37 3 rpmJ Large ribosomal subunit protein bL36 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
P47420 1.93e-10 51 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A5GIS5 2.06e-10 51 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain WH7803)
B9KZW4 2.08e-10 51 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
A9KJH0 2.15e-10 51 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q0ID25 2.25e-10 51 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain CC9311)
P80256 2.35e-10 51 68 1 38 1 rpmJ Large ribosomal subunit protein bL36 Thermus thermophilus
Q5SHR2 2.35e-10 51 68 1 38 1 rpmJ Large ribosomal subunit protein bL36 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72I28 2.35e-10 51 68 1 38 1 rpmJ Large ribosomal subunit protein bL36 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
C5CGH8 2.37e-10 51 65 0 38 3 rpmJ Large ribosomal subunit protein bL36 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
P59774 2.93e-10 51 71 1 38 3 rpl36 Large ribosomal subunit protein bL36c Chlamydomonas reinhardtii
Q32RU9 3.31e-10 51 65 1 38 3 rpl36 Large ribosomal subunit protein bL36c Staurastrum punctulatum
B2S2F7 3.69e-10 51 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Treponema pallidum subsp. pallidum (strain SS14)
O83239 3.69e-10 51 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Treponema pallidum (strain Nichols)
Q3A6M4 4.6e-10 50 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A0T0Z1 5.3e-10 50 65 1 38 3 rpl36 Large ribosomal subunit protein bL36c Thalassiosira pseudonana
B8DNK5 5.66e-10 50 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
C0Q9V1 5.73e-10 50 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B7K227 5.79e-10 50 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Rippkaea orientalis (strain PCC 8801 / RF-1)
B3DFA8 5.79e-10 50 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q98Q05 6.05e-10 50 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycoplasmopsis pulmonis (strain UAB CTIP)
C6C1A7 6.12e-10 50 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
P56360 6.12e-10 50 65 1 38 3 rpl36 Large ribosomal subunit protein bL36c Chlorella vulgaris
Q6AP47 6.32e-10 50 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A1VE94 6.9e-10 50 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CF8 6.9e-10 50 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q06J37 7.21e-10 50 65 1 38 3 rpl36 Large ribosomal subunit protein bL36c Bigelowiella natans
O24707 7.46e-10 50 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31L27 7.46e-10 50 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9TLU9 7.62e-10 50 68 1 38 3 rpl36 Large ribosomal subunit protein bL36c Cyanidium caldarium
B8IYL3 7.88e-10 50 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q1IX95 7.88e-10 50 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
C1F618 8.05e-10 50 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q32RN0 8.41e-10 50 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Zygnema circumcarinatum
A1KRJ5 1.06e-09 50 65 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66293 1.06e-09 50 65 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66292 1.06e-09 50 65 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3U4 1.06e-09 50 65 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Neisseria meningitidis serogroup C (strain 053442)
Q46501 1.14e-09 49 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q19VB5 1.18e-09 49 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Chlorokybus atmophyticus
Q4A5I7 1.41e-09 49 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycoplasmopsis synoviae (strain 53)
Q1KVS0 1.47e-09 49 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Tetradesmus obliquus
Q9XD13 1.66e-09 49 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P68994 1.7e-09 49 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B1X4Y8 2.03e-09 49 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Paulinella chromatophora
Q1WSB3 2.12e-09 49 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Ligilactobacillus salivarius (strain UCC118)
Q67JW7 2.16e-09 48 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q47LL8 2.31e-09 48 57 1 38 3 rpmJ Large ribosomal subunit protein bL36 Thermobifida fusca (strain YX)
Q6F1X0 2.31e-09 48 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
B2GDU6 2.38e-09 48 71 1 38 3 rpmJ Large ribosomal subunit protein bL36 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A4XBM2 2.39e-09 48 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B2ITN4 2.61e-09 48 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q49ZE5 2.67e-09 48 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4AAG3 2.98e-09 48 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q4A8J4 2.98e-09 48 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mesomycoplasma hyopneumoniae (strain 7448)
A6LLN7 3.13e-09 48 63 0 38 3 rpmJ Large ribosomal subunit protein bL36 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B7KI08 3.25e-09 48 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Gloeothece citriformis (strain PCC 7424)
Q6YXJ7 3.36e-09 48 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Physcomitrium patens
Q8G3Z6 3.51e-09 48 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bifidobacterium longum (strain NCC 2705)
B3DQD7 3.51e-09 48 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bifidobacterium longum (strain DJO10A)
A1A092 3.51e-09 48 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q8R7X8 3.67e-09 48 68 1 38 3 rpmJ Large ribosomal subunit protein bL36 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q110C8 4.14e-09 48 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Trichodesmium erythraeum (strain IMS101)
Q6A6Q7 4.62e-09 48 63 1 38 1 rpmJ Large ribosomal subunit protein bL36 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B8D0T3 4.99e-09 48 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B8HMS5 4.99e-09 48 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A8M504 5.16e-09 48 57 1 38 3 rpmJ Large ribosomal subunit protein bL36 Salinispora arenicola (strain CNS-205)
A6H5L5 5.45e-09 48 60 1 38 3 rpl36 Large ribosomal subunit protein bL36c Cycas taitungensis
Q3MFA0 6.57e-09 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8ETW1 6.57e-09 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8YPK0 6.57e-09 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A6TWF7 6.57e-09 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Alkaliphilus metalliredigens (strain QYMF)
A1T516 6.94e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A0PMB3 6.94e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium ulcerans (strain Agy99)
Q1BD12 6.94e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium sp. (strain MCS)
A1UBY1 6.94e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium sp. (strain KMS)
A3PVL4 6.94e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium sp. (strain JLS)
A0QSL4 6.94e-09 47 60 1 38 1 rpmJ Large ribosomal subunit protein bL36 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q73S47 6.94e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
B2HCX0 6.94e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium marinum (strain ATCC BAA-535 / M)
A0QKU9 6.94e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium avium (strain 104)
A4XLQ6 7.25e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MKF7 7.25e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A6MMP1 7.33e-09 47 57 1 38 3 rpl36 Large ribosomal subunit protein bL36c Dioscorea elephantipes
P9WH89 7.41e-09 47 60 1 38 1 rpmJ Large ribosomal subunit protein bL36 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH88 7.41e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U8D7 7.41e-09 47 60 1 38 1 rpmJ Large ribosomal subunit protein bL36 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AHR9 7.41e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPE7 7.41e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5W7 7.41e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q3A9U0 7.41e-09 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8DML2 8.18e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q4L891 8.84e-09 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus haemolyticus (strain JCSC1435)
Q8CRI2 8.84e-09 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM22 8.84e-09 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O98460 9.34e-09 47 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Spirogyra maxima
Q20F04 9.65e-09 47 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Oltmannsiellopsis viridis
P66302 9.75e-09 47 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P66301 9.75e-09 47 60 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q3BAK3 9.97e-09 47 57 1 38 3 rpl36 Large ribosomal subunit protein bL36c Phalaenopsis aphrodite subsp. formosana
A6MMF6 1.03e-08 47 57 1 38 3 rpl36 Large ribosomal subunit protein bL36c Chloranthus spicatus
P66300 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain MW2)
A8Z334 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G794 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain MSSA476)
Q6GEK6 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain MRSA252)
P66299 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain N315)
P66298 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ69 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain Newman)
Q5HDY1 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain COL)
A5IV11 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain JH9)
Q2FW29 1.09e-08 47 65 1 38 1 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER2 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain USA300)
A6U3V2 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain JH1)
A7X5C8 1.09e-08 47 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q1XDJ2 1.09e-08 47 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Neopyropia yezoensis
Q06FN0 1.46e-08 47 59 1 37 3 rpl36-A Large ribosomal subunit protein bL36c Pelargonium hortorum
B9DM54 1.53e-08 47 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Staphylococcus carnosus (strain TM300)
A6YGD2 1.56e-08 47 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Pleurastrum terricola
P51296 1.69e-08 47 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Porphyra purpurea
A7HM28 1.78e-08 47 57 0 38 3 rpmJ Large ribosomal subunit protein bL36 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B8E1F6 1.79e-08 46 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B5YDW6 1.79e-08 46 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B0TC81 1.97e-08 46 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A1SNJ2 2.04e-08 46 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q7NFF1 2.08e-08 46 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q06SJ4 2.1e-08 46 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Stigeoclonium helveticum
B0YPQ9 2.3e-08 46 57 1 38 3 rpl36 Large ribosomal subunit protein bL36c Aneura mirabilis
O50631 2.38e-08 46 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4J135 2.46e-08 46 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B3QYE6 2.55e-08 46 57 0 38 3 rpmJ Large ribosomal subunit protein bL36 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A8MLG5 2.59e-08 46 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Alkaliphilus oremlandii (strain OhILAs)
B2A4G1 2.62e-08 46 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q661C1 2.83e-08 46 64 1 37 3 rpmJ Large ribosomal subunit protein bL36 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q0SN08 2.83e-08 46 64 1 37 3 rpmJ Large ribosomal subunit protein bL36 Borreliella afzelii (strain PKo)
C5D3U1 2.86e-08 46 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Geobacillus sp. (strain WCH70)
P07841 2.86e-08 46 63 1 38 1 rpmJ Large ribosomal subunit protein bL36 Geobacillus stearothermophilus
Q18CI1 3.2e-08 46 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridioides difficile (strain 630)
Q97EK2 3.2e-08 46 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1MGA3 3.57e-08 46 57 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q5L3R5 4.03e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Geobacillus kaustophilus (strain HTA426)
B0K5R7 4.11e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Thermoanaerobacter sp. (strain X514)
B0KCM4 4.11e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q0SQG9 4.11e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium perfringens (strain SM101 / Type A)
Q8XHU7 4.11e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium perfringens (strain 13 / Type A)
Q0TMS1 4.11e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B2TIK0 4.11e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYD5 4.11e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain Alaska E43 / Type E3)
B1LBL6 4.94e-08 45 60 0 38 3 rpmJ Large ribosomal subunit protein bL36 Thermotoga sp. (strain RQ2)
A5IMA7 4.94e-08 45 60 0 38 3 rpmJ Large ribosomal subunit protein bL36 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1I6 4.94e-08 45 60 0 38 3 rpmJ Large ribosomal subunit protein bL36 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P48131 4.96e-08 45 63 1 38 3 rpl36 Large ribosomal subunit protein bL36c Cyanophora paradoxa
C0QQP7 5.3e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Persephonella marina (strain DSM 14350 / EX-H1)
B8I804 5.6e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B4SBX0 5.76e-08 45 57 0 38 3 rpmJ Large ribosomal subunit protein bL36 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B3QR94 5.76e-08 45 57 0 38 3 rpmJ Large ribosomal subunit protein bL36 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q3APJ6 5.76e-08 45 57 0 38 3 rpmJ Large ribosomal subunit protein bL36 Chlorobium chlorochromatii (strain CaD3)
A5N4S1 5.78e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYD3 5.78e-08 45 63 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium kluyveri (strain NBRC 12016)
A3DJJ7 5.85e-08 45 65 1 38 3 rpmJ Large ribosomal subunit protein bL36 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q48972 6.11e-08 45 57 1 38 3 rpmJ Large ribosomal subunit protein bL36 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6AD18 6.18e-08 45 60 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Leifsonia xyli subsp. xyli (strain CTCB07)
Q83G08 6.9e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Tropheryma whipplei (strain Twist)
Q83I57 6.9e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Tropheryma whipplei (strain TW08/27)
Q3ZJ79 6.97e-08 45 57 1 38 3 rpl36 Large ribosomal subunit protein bL36c Tupiella akineta
A0ALU5 7.21e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66290 7.21e-08 45 60 1 38 1 rpmJ Large ribosomal subunit protein bL36 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB31 7.21e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WG9 7.21e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Listeria monocytogenes serotype 4b (strain F2365)
P66291 7.21e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B8HCX7 8.31e-08 45 57 1 38 3 rpmJ Large ribosomal subunit protein bL36 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A0JZ52 8.31e-08 45 57 1 38 3 rpmJ1 Large ribosomal subunit protein bL36A Arthrobacter sp. (strain FB24)
B4S5A5 8.37e-08 45 57 0 38 3 rpmJ Large ribosomal subunit protein bL36 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A4SCT2 8.37e-08 45 57 0 38 3 rpmJ Large ribosomal subunit protein bL36 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q5WLN8 8.4e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Shouchella clausii (strain KSM-K16)
C0ZIK4 8.4e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q2RFS2 8.69e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B9E9L4 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Macrococcus caseolyticus (strain JCSC5402)
C4KZM2 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B1YGX4 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A0PXX1 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium novyi (strain NT)
B1KSK0 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ49 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGC9 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain Okra / Type B1)
C1FMS6 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain Kyoto / Type A2)
A5I7I1 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A6LPT6 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
C3KVM6 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ48 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Clostridium botulinum (strain ATCC 19397 / Type A)
A7Z0R2 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P20278 8.98e-08 45 60 1 38 1 rpmJ Large ribosomal subunit protein bL36 Bacillus subtilis (strain 168)
A8F9A9 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus pumilus (strain SAFR-032)
A9VPA1 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus mycoides (strain KBAB4)
Q65P82 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q81J20 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZL8 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cereus (strain Q1)
A7GK44 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HQW8 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cereus (strain AH187)
B7HJ72 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cereus (strain B4264)
C1ET63 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cereus (strain 03BB102)
B7IT43 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cereus (strain G9842)
Q73F72 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKE4 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus cereus (strain AH820)
Q81VQ6 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus anthracis
C3LJA6 8.98e-08 45 60 1 38 3 rpmJ Large ribosomal subunit protein bL36 Bacillus anthracis (strain CDC 684 / NRRL 3495)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18900
Feature type CDS
Gene rpmJ
Product 50S ribosomal protein L36
Location 12756 - 12872 (strand: -1)
Length 117 (nucleotides) / 38 (amino acids)
In genomic island -

Contig

Accession ZDB_544
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2411
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00444 Ribosomal protein L36

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0257 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L36

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02919 large subunit ribosomal protein L36 Ribosome -

Protein Sequence

MKVRASVKKLCRNCKIVKRHGVVRVICSAEPKHKQRQG

Flanking regions ( +/- flanking 50bp)

AAGGTTATAACCGTTAATTCGGTTTGCTTTAGAAGTTACGGAGAGTAAAAATGAAAGTTCGTGCTTCCGTCAAGAAATTATGCCGTAACTGCAAAATCGTTAAGCGTCACGGTGTCGTGCGCGTGATTTGCAGTGCTGAGCCTAAGCATAAACAGCGTCAAGGCTAATAAAAAGCATATTTTTCTTGCAAAGTTGGATTGAGCTGGCTAAATTAGCC