Homologs in group_2337

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18345 FBDBKF_18345 100.0 Morganella morganii S1 pasT type II toxin-antitoxin system RatA family toxin
EHELCC_18380 EHELCC_18380 100.0 Morganella morganii S2 pasT type II toxin-antitoxin system RatA family toxin
LHKJJB_18500 LHKJJB_18500 100.0 Morganella morganii S3 pasT type II toxin-antitoxin system RatA family toxin
HKOGLL_18235 HKOGLL_18235 100.0 Morganella morganii S5 pasT type II toxin-antitoxin system RatA family toxin
F4V73_RS01875 F4V73_RS01875 88.9 Morganella psychrotolerans - type II toxin-antitoxin system RatA family toxin
PMI_RS09400 PMI_RS09400 70.1 Proteus mirabilis HI4320 - type II toxin-antitoxin system RatA family toxin

Distribution of the homologs in the orthogroup group_2337

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2337

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AGL6 1.36e-79 234 75 0 142 3 ratA Ribosome association toxin RatA Shigella flexneri
P0AGL5 1.36e-79 234 75 0 142 1 ratA Ribosome association toxin RatA Escherichia coli (strain K12)
Q8FEY4 3.93e-79 233 74 0 142 1 pasT Persistence and stress-resistance toxin PasT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0C6Q0 7.55e-65 197 65 0 142 3 ratA Ribosome association toxin RatA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F376 7.55e-65 197 65 0 142 3 ratA Ribosome association toxin RatA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
O68560 8.1e-38 128 42 0 140 3 ratA Ribosome association toxin RatA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZDZ7 8.2e-22 87 30 3 147 3 ratA Ribosome association toxin RatA Rickettsia prowazekii (strain Madrid E)
Q6PBN4 2.46e-14 70 29 2 142 2 zgc:73324 Coenzyme Q-binding protein COQ10 homolog, mitochondrial Danio rerio
Q6GNP0 5.63e-14 69 30 3 144 2 coq10b Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Xenopus laevis
Q6DFA6 5.67e-11 61 27 2 144 2 coq10b-a Coenzyme Q-binding protein COQ10 homolog A, mitochondrial Xenopus laevis
Q96MF6 7.68e-11 61 26 2 131 1 COQ10A Coenzyme Q-binding protein COQ10 homolog A, mitochondrial Homo sapiens
Q556V1 6.36e-10 58 26 3 137 3 coq10-1 Coenzyme Q-binding protein COQ10, mitochondrial Dictyostelium discoideum
Q5RD79 1.01e-09 58 24 2 144 2 COQ10B Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Pongo abelii
Q9H8M1 1.1e-09 57 24 2 144 1 COQ10B Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Homo sapiens
Q3THF9 1.2e-09 57 25 2 144 1 Coq10b Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Mus musculus
Q5I0I9 1.29e-09 57 23 2 144 2 Coq10b Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Rattus norvegicus
Q9USM9 1.04e-07 51 25 3 144 3 coq10 Coenzyme Q-binding protein coq10, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q567E6 2.2e-07 51 24 2 144 2 coq10b Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Danio rerio
Q8MLL3 5.28e-07 50 24 2 139 2 Coq10 Coenzyme Q-binding protein COQ10, mitochondrial Drosophila melanogaster
Q08058 2.24e-05 45 27 5 140 1 COQ10 Coenzyme Q-binding protein COQ10, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18305
Feature type CDS
Gene pasT
Product type II toxin-antitoxin system RatA family toxin
Location 31091 - 31525 (strand: -1)
Length 435 (nucleotides) / 144 (amino acids)

Contig

Accession ZDB_540
Length 35191 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2337
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03364 Polyketide cyclase / dehydrase and lipid transport

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2867 Translation, ribosomal structure and biogenesis (J) J Ribosome association toxin PasT (RatA) of the RatAB toxin-antitoxin module

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18588 coenzyme Q-binding protein COQ10 - -

Protein Sequence

MPQISRSALVPFSVEQMYNLVNDVRAYPEFLPGCVGSRIISHGQDEMTASVDVSKAGISKTFVTRNQLTSNQHIRMQLVEGPFRKLMGGWSFIPLSPEACKVELNLDFEFTNKLVELAFGRIFKELAGNMVMAFTKRAKEVYRV

Flanking regions ( +/- flanking 50bp)

AGGCGGCGATAATTTCCGCCGTTTCGTGATTTTTGACCGCAGGATGTGTTATGCCGCAAATTAGCCGCTCCGCACTGGTTCCGTTCAGTGTGGAACAGATGTACAACCTGGTGAATGATGTCCGTGCGTATCCGGAATTTTTACCGGGCTGCGTGGGAAGCCGTATTATCAGCCACGGGCAGGATGAGATGACCGCGTCTGTGGATGTATCCAAAGCCGGTATCAGTAAAACCTTTGTGACCCGCAATCAGCTGACCAGCAATCAGCATATCCGTATGCAGCTGGTGGAAGGCCCGTTCCGTAAACTGATGGGTGGCTGGTCGTTTATTCCGCTGAGTCCTGAGGCGTGCAAAGTTGAACTGAATCTGGATTTTGAATTTACCAATAAACTGGTTGAGCTGGCCTTCGGCCGTATATTTAAAGAGCTGGCCGGTAATATGGTGATGGCATTTACCAAACGGGCAAAAGAGGTTTACCGTGTCTGATATTTCTGTTGAAGTCTGTTATGCCCTGCCTGATAAACAGTTTCTGATCC