Homologs in group_2370

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18345 FBDBKF_18345 88.9 Morganella morganii S1 pasT type II toxin-antitoxin system RatA family toxin
EHELCC_18380 EHELCC_18380 88.9 Morganella morganii S2 pasT type II toxin-antitoxin system RatA family toxin
NLDBIP_18305 NLDBIP_18305 88.9 Morganella morganii S4 pasT type II toxin-antitoxin system RatA family toxin
LHKJJB_18500 LHKJJB_18500 88.9 Morganella morganii S3 pasT type II toxin-antitoxin system RatA family toxin
HKOGLL_18235 HKOGLL_18235 88.9 Morganella morganii S5 pasT type II toxin-antitoxin system RatA family toxin
PMI_RS09400 PMI_RS09400 68.8 Proteus mirabilis HI4320 - type II toxin-antitoxin system RatA family toxin

Distribution of the homologs in the orthogroup group_2370

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2370

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FEY4 1.78e-81 239 76 0 143 1 pasT Persistence and stress-resistance toxin PasT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGL6 1.18e-80 237 75 0 143 3 ratA Ribosome association toxin RatA Shigella flexneri
P0AGL5 1.18e-80 237 75 0 143 1 ratA Ribosome association toxin RatA Escherichia coli (strain K12)
P0C6Q0 2.52e-64 196 64 0 142 3 ratA Ribosome association toxin RatA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F376 2.52e-64 196 64 0 142 3 ratA Ribosome association toxin RatA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
O68560 5.64e-37 126 42 0 140 3 ratA Ribosome association toxin RatA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZDZ7 4.27e-21 86 30 3 145 3 ratA Ribosome association toxin RatA Rickettsia prowazekii (strain Madrid E)
Q6PBN4 7.23e-13 66 28 2 142 2 zgc:73324 Coenzyme Q-binding protein COQ10 homolog, mitochondrial Danio rerio
Q6GNP0 1.91e-12 65 29 3 144 2 coq10b Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Xenopus laevis
Q556V1 7.34e-11 60 27 3 137 3 coq10-1 Coenzyme Q-binding protein COQ10, mitochondrial Dictyostelium discoideum
Q6DFA6 8.94e-11 60 28 2 138 2 coq10b-a Coenzyme Q-binding protein COQ10 homolog A, mitochondrial Xenopus laevis
Q5I0I9 1.98e-10 60 26 2 138 2 Coq10b Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Rattus norvegicus
Q96MF6 4.73e-10 58 28 2 131 1 COQ10A Coenzyme Q-binding protein COQ10 homolog A, mitochondrial Homo sapiens
Q3THF9 7.38e-10 58 27 2 135 1 Coq10b Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Mus musculus
Q5RD79 2.11e-09 57 25 2 135 2 COQ10B Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Pongo abelii
Q9H8M1 2.24e-09 57 25 2 135 1 COQ10B Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Homo sapiens
Q9USM9 2.76e-08 53 25 3 144 3 coq10 Coenzyme Q-binding protein coq10, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q567E6 5.7e-07 50 24 2 138 2 coq10b Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Danio rerio
Q08058 2.12e-06 48 27 5 134 1 COQ10 Coenzyme Q-binding protein COQ10, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8MLL3 1.22e-05 46 25 3 139 2 Coq10 Coenzyme Q-binding protein COQ10, mitochondrial Drosophila melanogaster

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01875
Feature type CDS
Gene -
Product type II toxin-antitoxin system RatA family toxin
Location 409646 - 410080 (strand: -1)
Length 435 (nucleotides) / 144 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2370
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03364 Polyketide cyclase / dehydrase and lipid transport

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2867 Translation, ribosomal structure and biogenesis (J) J Ribosome association toxin PasT (RatA) of the RatAB toxin-antitoxin module

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18588 coenzyme Q-binding protein COQ10 - -

Protein Sequence

MPQINRSALVPFSVEQMYNLVNDVHSYPEFLPGCVGSRILSREPDEMTAAVEVSKAGISKTFVTRNQLTNNQHISMQLVEGPFRKLMGGWSFIPLSDDACKVELSLDFEFTNKLVELAFGRIFKELAGNMVMAFTRRAKEVYSV

Flanking regions ( +/- flanking 50bp)

TACCTCACCGGCAGGTCGCCGTTTTTGACTTTCTTATTGCAGGATTTGTTATGCCACAAATTAACCGCTCTGCACTTGTGCCTTTCAGTGTGGAACAGATGTACAACCTTGTAAATGATGTCCACTCTTATCCGGAATTTTTACCCGGATGTGTGGGAAGCCGGATCCTCAGCCGGGAACCGGATGAAATGACGGCCGCGGTCGAGGTGTCAAAAGCCGGGATAAGTAAGACATTTGTCACACGTAATCAACTGACGAATAATCAGCACATCAGCATGCAGTTAGTTGAAGGCCCATTCCGTAAGCTTATGGGTGGATGGTCATTTATCCCTCTGAGTGATGATGCCTGTAAAGTGGAACTGAGCCTGGACTTTGAGTTTACTAATAAGCTGGTTGAACTGGCCTTCGGGCGTATTTTCAAAGAACTGGCCGGTAATATGGTGATGGCATTTACCCGCAGGGCAAAAGAGGTTTACAGTGTCTGATATATCTATCGAGGTTTGTTATGCATTACCGGAGAAACAATTTCTGATCC