Homologs in group_2328

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17620 FBDBKF_17620 100.0 Morganella morganii S1 thiS sulfur carrier protein ThiS
EHELCC_18105 EHELCC_18105 100.0 Morganella morganii S2 thiS sulfur carrier protein ThiS
LHKJJB_18240 LHKJJB_18240 100.0 Morganella morganii S3 thiS sulfur carrier protein ThiS
HKOGLL_17960 HKOGLL_17960 100.0 Morganella morganii S5 thiS sulfur carrier protein ThiS
F4V73_RS15000 F4V73_RS15000 68.2 Morganella psychrotolerans thiS sulfur carrier protein ThiS
PMI_RS13730 PMI_RS13730 51.5 Proteus mirabilis HI4320 thiS sulfur carrier protein ThiS

Distribution of the homologs in the orthogroup group_2328

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2328

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O32583 2.47e-17 71 54 0 66 1 thiS Sulfur carrier protein ThiS Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18045
Feature type CDS
Gene thiS
Product sulfur carrier protein ThiS
Location 18948 - 19148 (strand: 1)
Length 201 (nucleotides) / 66 (amino acids)
In genomic island -

Contig

Accession ZDB_539
Length 38736 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2328
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02597 ThiS family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2104 Coenzyme transport and metabolism (H) H Sulfur carrier protein ThiS (thiamine biosynthesis)

Kegg Ortholog Annotation(s)

Protein Sequence

MRITVNDEVMDIDPPITVSELLAFLGRPVAGIAVAVNQAIVVRGCWSEHVVRDGDQILLFQAIAGG

Flanking regions ( +/- flanking 50bp)

TTACAGCTCCGGCGGGCGGCAGAGTGCCCGGTGTGTCAGGAGGCAGCCGCATGCGCATAACGGTGAATGACGAGGTGATGGATATAGATCCCCCCATTACCGTCAGTGAACTGCTGGCATTTCTCGGCCGTCCCGTGGCGGGTATTGCTGTCGCGGTAAACCAAGCCATTGTTGTCCGTGGCTGCTGGTCAGAACACGTTGTCCGCGACGGCGATCAGATTTTACTTTTTCAGGCTATCGCAGGAGGTTAATGATGCTGACGATTGCAGATACCACATTTACGTCCCATTTATTTACCGGC