Homologs in group_2267

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17435 FBDBKF_17435 100.0 Morganella morganii S1 phoB phosphate regulon transcriptional regulator PhoB
EHELCC_17330 EHELCC_17330 100.0 Morganella morganii S2 phoB phosphate regulon transcriptional regulator PhoB
LHKJJB_17785 LHKJJB_17785 100.0 Morganella morganii S3 phoB phosphate regulon transcriptional regulator PhoB
HKOGLL_17795 HKOGLL_17795 100.0 Morganella morganii S5 phoB phosphate regulon transcriptional regulator PhoB
F4V73_RS16610 F4V73_RS16610 95.2 Morganella psychrotolerans phoB phosphate regulon transcriptional regulator PhoB
PMI_RS00250 PMI_RS00250 81.2 Proteus mirabilis HI4320 phoB phosphate regulon transcriptional regulator PhoB

Distribution of the homologs in the orthogroup group_2267

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2267

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45606 5.26e-144 404 81 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 6.77e-144 404 81 0 229 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 6.77e-144 404 81 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45607 1.52e-143 403 80 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P45605 6.7e-141 396 79 0 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P23620 1.23e-97 286 59 1 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45189 4.71e-79 239 51 2 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q52990 1.14e-69 216 48 0 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P35163 3.53e-58 187 42 3 233 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P39663 4.86e-57 184 45 4 236 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P32040 5.36e-55 179 44 5 234 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q7A0U4 5.54e-53 174 40 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 5.54e-53 174 40 3 237 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 5.54e-53 174 40 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 5.54e-53 174 40 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 5.54e-53 174 40 3 237 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 5.54e-53 174 40 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 5.54e-53 174 40 3 237 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 5.54e-53 174 40 3 237 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q7A216 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 1.62e-52 172 42 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 1.62e-52 172 42 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 1.62e-52 172 42 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 1.62e-52 172 42 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4A160 2.42e-52 172 41 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CQK0 4.5e-52 171 41 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 4.5e-52 171 41 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4LAJ9 5.01e-52 171 41 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P13792 9.74e-51 168 41 4 235 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P37478 2.51e-50 166 41 3 230 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
P94413 1e-49 165 39 5 228 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P0C001 2.52e-49 163 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 2.52e-49 163 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 2.52e-49 163 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 2.52e-49 163 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 2.52e-49 163 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 2.52e-49 163 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 2.52e-49 163 39 3 220 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 2.52e-49 163 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P69228 3.62e-49 164 40 4 226 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 3.62e-49 164 40 4 226 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P9WGL9 1.58e-48 162 39 3 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 1.58e-48 162 39 3 225 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 1.58e-48 162 39 3 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O78428 7.05e-48 161 39 4 231 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q9F868 3.33e-47 158 38 3 226 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P28835 3.62e-47 159 38 4 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
A1KHB7 1.01e-46 157 39 2 225 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 1.01e-46 157 39 2 225 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CD68 1.08e-46 157 38 2 222 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
A1TEL7 1.09e-46 157 39 3 226 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
L7N689 1.15e-46 158 40 4 222 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM9 2.17e-46 156 38 2 225 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 2.17e-46 156 38 2 225 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 2.17e-46 156 38 2 225 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q1B3X8 2.61e-46 156 40 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 2.61e-46 156 40 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 2.61e-46 156 40 2 225 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q742C1 3.19e-46 155 39 2 222 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 3.19e-46 155 39 2 222 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q4L6C6 3.52e-46 155 38 3 219 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
Q8DPL7 5.84e-46 155 38 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 5.84e-46 155 38 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 5.84e-46 155 38 3 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P51358 6.33e-46 155 39 4 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 1.05e-45 155 39 4 231 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q31S42 2.13e-45 154 39 3 228 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0R3I8 3.03e-45 153 39 3 225 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q99U73 4.22e-45 152 38 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
A0PWB4 6.18e-44 150 38 3 227 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q93CB8 3.87e-43 148 42 3 225 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 4.68e-43 147 42 3 225 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 4.68e-43 147 42 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 4.68e-43 147 42 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CCJ2 6.49e-43 147 42 3 225 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P28257 8.25e-43 148 38 4 231 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
O34903 8.48e-43 147 37 3 222 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
G3XCY6 1.16e-42 147 37 3 226 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A4P7TS68 1.43e-42 147 36 6 232 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 1.43e-42 147 36 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 1.43e-42 147 36 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 1.43e-42 147 36 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 1.43e-42 147 36 6 232 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 1.43e-42 147 36 6 232 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 1.43e-42 147 36 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 1.43e-42 147 36 6 232 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P42244 3.71e-42 145 36 3 227 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
P48259 4.71e-42 145 37 5 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
A0QTK2 1.06e-41 144 41 3 225 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9I0I1 1.31e-41 144 36 4 224 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P21866 1.8e-41 144 36 3 223 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P54884 2.34e-41 142 41 3 196 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q06239 3e-41 143 35 5 232 3 vanR Regulatory protein VanR Enterococcus faecium
Q9KM23 3.24e-41 143 36 4 226 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5HPC3 3.46e-41 142 37 2 219 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q55890 7.66e-41 142 37 3 225 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8CP82 8.01e-41 142 38 4 220 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q07783 8.26e-41 142 36 4 241 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q49XM7 1.52e-40 141 36 2 220 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q49ZT8 1.72e-40 141 35 2 219 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9I4F9 1.99e-40 141 36 2 225 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8CN92 6.47e-40 139 34 2 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLN2 7.2e-40 139 34 2 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9ZEP4 9.35e-40 139 36 4 233 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P94504 9.4e-40 139 36 4 226 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q82EB1 1.14e-39 139 37 5 234 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P0A4I0 1.26e-39 139 37 3 225 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.26e-39 139 37 3 225 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P0ACZ8 2.29e-39 138 35 1 224 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 2.29e-39 138 35 1 224 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 2.29e-39 138 35 1 224 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
O69730 2.57e-39 138 39 3 221 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P54443 2.7e-39 138 37 6 232 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
Q9TLQ4 5.21e-39 138 36 4 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q7D9K0 5.66e-39 138 38 2 222 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 5.66e-39 138 38 2 222 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P76340 1.73e-38 135 36 5 224 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
P08368 1.81e-38 136 36 3 221 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q2YZ24 2.07e-38 135 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4L8L9 2.71e-38 135 34 2 221 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q8CQ17 5.84e-38 134 38 6 228 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 5.84e-38 134 38 6 228 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q04942 8.15e-38 134 36 3 222 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9ZHD3 1.02e-37 134 36 3 226 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q7A1J1 1.08e-37 134 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 1.08e-37 134 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 1.08e-37 134 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 1.08e-37 134 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 1.08e-37 134 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 1.08e-37 134 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 1.08e-37 134 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 1.08e-37 134 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 1.08e-37 134 36 4 225 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 1.08e-37 134 36 4 225 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
Q44006 1.09e-37 134 38 2 220 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9HV32 1.59e-37 133 38 3 220 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P44918 1.77e-37 134 35 4 231 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q50136 1.94e-37 133 38 2 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q6GE73 3.5e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
P9WGM1 3.74e-37 132 38 2 204 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 3.74e-37 132 38 2 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 3.74e-37 132 38 2 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7A039 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 6.18e-37 132 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P50351 6.78e-37 132 36 3 237 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P50350 9.92e-37 132 36 4 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
A6QJK3 1.66e-36 130 33 2 221 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 1.66e-36 130 33 2 221 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
Q02540 2.25e-36 130 35 1 220 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
A0A0H3GGB5 2.41e-36 130 38 5 229 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
O06978 2.49e-36 130 33 3 230 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q44929 3.18e-36 130 33 4 237 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P44895 4.38e-36 130 39 5 225 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AE90 5.74e-36 129 38 6 229 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 5.74e-36 129 38 6 229 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 5.74e-36 129 38 6 229 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q47456 2.25e-35 128 34 2 226 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q55933 7.91e-35 127 35 7 235 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8Z7H2 1.13e-34 126 33 2 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P31079 3.47e-34 125 34 7 232 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q83RR0 3.49e-34 125 31 2 225 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 3.49e-34 125 31 2 225 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23836 4.1e-34 124 31 2 225 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
P0DM78 4.11e-34 124 33 2 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 4.11e-34 124 33 2 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 4.11e-34 124 33 2 225 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 4.11e-34 124 33 2 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 4.11e-34 124 33 2 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P42421 5.98e-34 124 30 2 226 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
P0A9Q4 1.12e-33 124 34 4 231 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 1.12e-33 124 34 4 231 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 1.12e-33 124 34 4 231 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 1.12e-33 124 34 4 231 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q8X738 1.6e-33 123 31 2 225 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P9WGN1 1.78e-33 123 34 3 224 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 1.78e-33 123 34 3 224 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q57QC3 2.12e-33 122 33 3 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q9HUI2 3.14e-33 123 34 6 242 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DMK7 3.28e-33 122 36 2 225 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 3.28e-33 122 36 2 225 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
O32192 3.37e-33 122 32 4 228 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
P45337 1.82e-32 120 34 3 220 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DN02 2.33e-32 120 34 4 224 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 2.33e-32 120 34 4 224 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8GP20 2.88e-32 119 34 4 219 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q47744 4.78e-32 119 32 3 225 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q01473 1.77e-31 124 39 5 180 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 2.92e-05 48 22 0 127 3 rcaC Protein RcaC Microchaete diplosiphon
P58357 1.09e-30 116 33 6 231 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P0CL17 2.04e-30 115 36 4 220 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 2.04e-30 115 36 4 220 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P52076 3.52e-30 114 35 6 225 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q8XBS3 4.6e-30 114 35 6 225 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q9K621 9.74e-30 113 27 2 222 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P38684 1.41e-29 113 33 6 231 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
Q2FWH6 1.49e-29 113 29 3 228 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GJ11 1.51e-29 112 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q8CQ37 3.85e-29 112 27 2 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 3.85e-29 112 27 2 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L481 6.35e-29 111 27 2 222 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q9AE24 7.83e-29 111 29 3 224 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
P0A4I2 8.2e-29 110 37 4 223 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 8.2e-29 110 37 4 223 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2YSS2 1.01e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A1L2 1.12e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 1.12e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 1.12e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 1.12e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 1.12e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 1.12e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q932F1 1.25e-28 110 27 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0A4H8 1.49e-28 110 29 3 220 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.49e-28 110 29 3 220 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A8Z181 1.86e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 1.86e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 1.86e-28 110 27 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 1.86e-28 110 27 2 222 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 1.86e-28 110 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q70FH0 8.27e-28 108 32 4 223 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
B8H358 1.99e-27 107 30 4 221 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.99e-27 107 30 4 221 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q49VK3 3.27e-27 107 26 2 221 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P66795 3.52e-27 106 32 3 223 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 3.52e-27 106 32 3 223 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
A6WZ81 7.11e-27 106 31 6 223 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FZ93 1.01e-26 105 31 6 223 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.01e-26 105 31 6 223 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.01e-26 105 31 6 223 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.01e-26 105 31 6 223 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.01e-26 105 31 6 223 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.01e-26 105 31 6 223 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.01e-26 105 31 6 223 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.01e-26 105 31 6 223 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P33112 2.07e-26 104 34 3 222 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
P36556 4.75e-26 103 31 3 220 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P30843 3.43e-25 101 32 3 220 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
O34951 2.06e-24 99 25 2 222 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
O31432 7.34e-24 98 28 9 228 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P13359 1.38e-23 97 31 8 231 3 virG Regulatory protein VirG Rhizobium rhizogenes
Q04803 1.74e-23 99 33 3 222 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P62722 2.05e-22 95 32 8 231 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q07597 3.23e-22 94 27 6 244 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
O24973 3.3e-22 94 31 3 223 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q44444 3.48e-22 94 32 8 231 3 virG Regulatory protein VirG Rhizobium radiobacter
P07545 4.62e-22 94 31 8 232 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P55701 1.18e-21 92 29 2 176 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O25918 1.06e-19 87 30 7 227 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P52108 2.02e-19 86 28 5 237 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
Q05943 4.03e-19 86 39 4 131 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P43501 1.25e-18 81 34 0 117 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P46384 3.3e-18 80 32 0 125 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8GZM2 4.04e-18 85 41 2 122 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
B8GZM2 1.31e-05 48 27 1 122 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 4.04e-18 85 41 2 122 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A5I5 1.31e-05 48 27 1 122 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P72781 4.55e-18 82 38 1 119 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9KQD5 9.39e-17 77 32 1 121 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 9.39e-17 77 32 1 121 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q54SP4 2.84e-16 80 37 1 112 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 0.000362 45 24 2 137 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P48359 3.3e-16 77 26 3 202 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
T2KMF4 4.33e-16 80 26 5 216 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q51455 6.67e-16 74 28 1 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1XDE4 4.18e-15 74 29 0 122 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q8D0P1 5.81e-15 72 30 1 122 3 cheY Chemotaxis protein CheY Yersinia pestis
Q9HV27 7.52e-15 75 48 0 78 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q93P00 7.71e-15 72 30 1 122 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P71403 9.84e-15 71 30 2 119 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
P24072 1.95e-14 70 32 3 123 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
P0A2D5 3.68e-14 70 27 1 122 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 3.68e-14 70 27 1 122 3 cheY Chemotaxis protein CheY Salmonella typhi
Q9ZM64 4.03e-14 69 29 2 119 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P0AE69 9.8e-14 68 27 1 122 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 9.8e-14 68 27 1 122 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 9.8e-14 68 27 1 122 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q8FGP6 1.1e-13 68 27 1 122 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8KIY1 1.66e-13 72 36 2 119 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q9FAD7 1.85e-13 68 27 1 122 3 cheY Chemotaxis protein CheY Enterobacter cloacae
E0X9C7 3.67e-13 71 35 1 117 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
P40138 3.88e-13 70 37 2 123 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q04849 3.99e-13 71 35 2 115 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P06628 4.83e-13 67 37 2 121 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q8FW53 1.18e-12 65 30 0 120 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 1.18e-12 65 30 0 120 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 1.18e-12 65 30 0 120 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 1.18e-12 65 30 0 120 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 1.18e-12 65 30 0 120 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 1.18e-12 65 30 0 120 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 1.18e-12 65 30 0 120 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 1.18e-12 65 30 0 120 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
A5W4E3 1.36e-12 70 35 1 117 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P51586 2.8e-12 65 33 0 123 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
A6X580 3.21e-12 64 30 0 120 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P23221 5.74e-12 65 29 1 131 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q06065 5.85e-12 67 35 1 109 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q56312 6.21e-11 61 31 3 115 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9I4N3 8.59e-11 64 26 4 193 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1W0A5 1.17e-10 60 23 1 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.17e-10 60 23 1 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.17e-10 60 23 1 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A2XYV5 1.38e-10 61 28 2 120 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
Q7XQA6 1.47e-10 61 28 2 120 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
Q4UU85 3.73e-10 62 32 1 119 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P51343 4.48e-10 60 40 0 64 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q2HWH1 4.9e-10 58 27 1 118 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 4.9e-10 58 27 1 118 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
Q54YZ9 6.36e-10 62 31 1 118 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
P96686 6.95e-10 60 30 2 120 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P52942 7.83e-10 58 33 1 112 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
B0R4K1 1.88e-09 57 30 2 121 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P41789 1.96e-09 60 29 1 136 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45365 4.11e-09 59 27 0 118 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
Q9KSB1 5.28e-09 58 35 2 119 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1RJS1 8.58e-09 58 30 2 115 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P30198 9.62e-09 57 24 3 154 4 epiQ Putative epidermin response regulator Staphylococcus epidermidis
Q9KM66 9.68e-09 58 28 1 117 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9WY30 1.17e-08 57 34 3 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6H468 1.24e-08 55 26 1 109 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 1.24e-08 55 26 1 109 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
Q00934 1.94e-08 57 33 3 126 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9F8D7 2.32e-08 57 33 3 119 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P0AFB8 3.17e-08 56 27 1 136 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 3.17e-08 56 27 1 136 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q55169 3.61e-08 54 32 2 126 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4UL27 3.8e-08 56 30 2 115 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P9WGM3 3.92e-08 55 31 2 127 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 3.92e-08 55 31 2 127 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q0PVB3 5.25e-08 55 26 1 109 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. japonica
Q68WH4 7.86e-08 55 29 2 115 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P48027 8.66e-08 55 31 1 118 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q9LKL2 8.94e-08 55 30 1 121 1 APRR1 Two-component response regulator-like APRR1 Arabidopsis thaliana
Q92HC2 1.03e-07 55 30 2 111 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O83639 1.09e-07 55 33 5 124 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q9ZCY9 1.1e-07 55 29 2 115 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
P23747 1.11e-07 55 33 1 109 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8EQQ3 1.19e-07 54 31 3 125 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q88RJ6 1.37e-07 54 33 1 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P26487 1.43e-07 53 28 3 119 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q6K9T0 1.5e-07 52 25 1 109 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 1.5e-07 52 25 1 109 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
P42012 1.56e-07 54 31 0 85 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
P94514 1.56e-07 53 26 4 128 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
P0A4I4 1.74e-07 53 25 2 125 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 1.74e-07 53 25 2 125 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8FUS8 1.77e-07 53 22 7 217 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 1.77e-07 53 22 7 217 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 1.77e-07 53 22 7 217 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 1.77e-07 53 22 7 217 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
Q88AQ2 1.87e-07 54 32 1 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2KCH7 2.01e-07 52 24 1 118 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P52928 2.79e-07 53 27 2 118 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
O25153 3.66e-07 53 26 1 115 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q30RX5 4.04e-07 53 31 4 132 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P18769 4.26e-07 53 30 0 102 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q7A0I0 4.72e-07 52 27 3 136 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 4.72e-07 52 27 3 136 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 4.72e-07 52 27 3 136 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 4.72e-07 52 27 3 136 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 4.72e-07 52 27 3 136 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 4.72e-07 52 27 3 136 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P03029 4.83e-07 53 30 1 110 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
A5VW00 5.36e-07 52 22 7 217 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q0D3B6 5.46e-07 53 28 1 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
A2YQ93 6.16e-07 53 28 1 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q86AT9 7.55e-07 53 30 3 120 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
Q4GZK4 1.08e-06 51 26 2 109 2 RR7 Two-component response regulator ORR7 Oryza sativa subsp. indica
Q9HWA4 1.12e-06 51 27 2 111 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4GZL0 1.2e-06 51 28 4 132 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. indica
O05251 1.24e-06 51 33 3 106 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q5A599 1.39e-06 52 25 1 131 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q1IQS9 1.53e-06 51 31 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q2RAP3 1.55e-06 50 26 1 118 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. japonica
Q4GZK2 1.55e-06 50 26 1 118 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. indica
P52929 1.76e-06 50 31 1 107 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q4L8V4 1.78e-06 50 28 4 159 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q2QXY3 2.09e-06 50 27 2 118 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. japonica
B8BLZ4 2.09e-06 50 27 2 118 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. indica
P52934 2.25e-06 50 26 4 131 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q2HWG4 2.44e-06 50 28 4 132 2 RR1 Two-component response regulator ORR1 Oryza sativa subsp. japonica
A0A0H3MDW1 2.53e-06 50 29 2 148 1 chxR Atypical response regulator protein ChxR Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q10N34 2.6e-06 51 29 1 121 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
G7WMP8 2.6e-06 49 33 4 123 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
A2XFB7 2.62e-06 51 29 1 121 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q95PI2 2.7e-06 51 25 3 121 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
Q9KT84 3.63e-06 50 32 1 83 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8L9Y3 3.77e-06 50 31 3 129 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
P96126 4.31e-06 48 28 4 122 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q9ZWS9 4.84e-06 49 30 1 82 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
Q10WZ6 5.65e-06 50 29 4 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
P06534 5.71e-06 49 29 5 122 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P14375 5.84e-06 50 33 1 116 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
P0A4H5 5.99e-06 47 27 3 106 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 5.99e-06 47 27 3 106 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9AAK0 6.38e-06 49 34 3 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7MM78 7.17e-06 49 30 1 92 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 7.17e-06 49 30 1 92 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q8X613 7.85e-06 49 33 1 116 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P13800 8.85e-06 48 23 10 239 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
P26275 9.05e-06 48 27 6 170 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HUI3 9.19e-06 49 30 1 110 3 aruS Sensor histidine kinase AruS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P10046 9.77e-06 49 26 1 113 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P55184 1.03e-05 48 30 3 129 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
P10958 1.08e-05 48 26 2 101 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
Q9SB04 1.1e-05 47 35 0 59 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
Q9APD9 1.19e-05 48 33 1 103 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P0C5S5 1.22e-05 48 29 1 89 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.22e-05 48 29 1 89 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q8L500 1.25e-05 48 27 1 123 1 APRR9 Two-component response regulator-like APRR9 Arabidopsis thaliana
Q67W50 1.32e-05 49 32 3 112 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
O82798 1.33e-05 48 35 0 59 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
Q87MX7 1.36e-05 48 29 1 89 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q689G9 1.41e-05 48 33 0 75 1 PRR1 Two-component response regulator-like PRR1 Oryza sativa subsp. japonica
Q52376 1.48e-05 47 29 4 133 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
P95582 1.57e-05 47 29 4 133 3 gacA Response regulator GacA Pseudomonas viridiflava
P62646 1.6e-05 48 30 3 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q1MC14 1.64e-05 48 33 3 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9SXL4 1.65e-05 48 25 4 154 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
P0AEV3 1.67e-05 48 28 1 106 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.67e-05 48 28 1 106 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.67e-05 48 28 1 106 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q9ZWS6 1.69e-05 47 33 0 59 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
P06184 1.71e-05 48 29 3 108 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45671 1.75e-05 48 28 1 127 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q1RAQ1 1.77e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain UTI89 / UPEC)
Q0TGV0 1.77e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P07330 1.86e-05 48 33 5 108 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain K12)
Q83R52 1.87e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella flexneri
Q3Z2R1 1.91e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella sonnei (strain Ss046)
Q8FGP5 1.91e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XCF9 1.91e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O157:H7
Q5V0B3 1.92e-05 48 28 5 137 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q322K2 2.03e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella boydii serotype 4 (strain Sb227)
Q8Z5V2 2.11e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhi
P15940 2.15e-05 47 28 3 121 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P04042 2.21e-05 48 33 5 108 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PMY3 2.21e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57N81 2.21e-05 48 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella choleraesuis (strain SC-B67)
Q7NSI8 2.27e-05 48 30 3 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P52936 2.34e-05 47 32 2 87 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A7N6S2 2.44e-05 48 25 1 115 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q93WK5 2.45e-05 48 29 1 121 1 APRR7 Two-component response regulator-like APRR7 Arabidopsis thaliana
Q8DET1 2.56e-05 47 28 5 139 3 VV1_0503 Uncharacterized response regulatory protein VV1_0503 Vibrio vulnificus (strain CMCP6)
O82868 2.6e-05 47 25 1 110 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q9HU19 2.63e-05 48 24 1 117 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9FPR6 2.68e-05 46 31 0 60 2 ARR17 Two-component response regulator ARR17 Arabidopsis thaliana
Q8PX96 2.95e-05 47 28 5 159 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P0AED6 3.03e-05 47 25 3 127 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 3.03e-05 47 25 3 127 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q52883 3.08e-05 47 33 5 128 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q04848 3.17e-05 47 30 3 113 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
O07528 3.17e-05 47 31 3 112 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P44845 3.21e-05 47 23 8 218 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P66797 3.21e-05 47 25 3 127 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 3.21e-05 47 25 3 127 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q9SHC2 3.37e-05 46 32 0 59 1 ARR16 Two-component response regulator ARR16 Arabidopsis thaliana
P9WGM5 3.44e-05 47 32 4 121 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 3.44e-05 47 32 4 121 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9FAD8 3.65e-05 47 33 5 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Enterobacter cloacae
Q1GZZ0 3.78e-05 47 31 4 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q9LYP5 3.79e-05 47 24 3 112 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
Q8Z333 4.24e-05 47 33 1 103 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P25852 4.32e-05 47 33 1 103 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3LWR6 4.66e-05 46 31 1 72 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 4.66e-05 46 31 1 72 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 4.66e-05 46 31 1 72 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q814J1 4.69e-05 46 27 2 112 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q689G6 4.92e-05 47 29 1 114 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
P10577 5.84e-05 47 29 3 111 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
O14002 6.24e-05 47 29 4 120 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O78417 6.99e-05 45 39 0 46 3 ycf29 Probable transcriptional regulator ycf29 Guillardia theta
P28787 7.42e-05 46 27 1 113 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q942A1 7.49e-05 46 23 2 146 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. japonica
Q4GZK7 7.49e-05 46 23 2 146 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. indica
P24908 8.47e-05 45 30 2 103 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q81JL3 9.03e-05 45 27 2 112 3 lytT Sensory transduction protein LytT Bacillus anthracis
A8R3S7 9.53e-05 45 22 7 220 2 exaE Transcriptional activator protein ExaE Pseudomonas putida
Q39KQ1 9.8e-05 46 32 4 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1IRH0 0.0001 46 27 6 138 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q1D823 0.000102 46 31 4 148 1 aglZ Adventurous-gliding motility protein Z Myxococcus xanthus (strain DK1622)
Q5SML5 0.000104 46 28 2 121 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 0.000104 46 28 2 121 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q87S86 0.000107 45 30 5 139 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9FXD6 0.000108 46 28 2 121 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
P23890 0.000109 46 32 2 89 1 cadC Transcriptional activator CadC Escherichia coli (strain K12)
Q1BRL2 0.00011 46 32 4 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
P45709 0.000111 43 28 3 119 3 ccdB Protein CcdB Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_17865
Feature type CDS
Gene phoB
Product phosphate regulon transcriptional regulator PhoB
Location 23476 - 24165 (strand: 1)
Length 690 (nucleotides) / 229 (amino acids)

Contig

Accession ZDB_538
Length 42795 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2267
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07657 two-component system, OmpR family, phosphate regulon response regulator PhoB Two-component system -

Protein Sequence

MARRILVVEDEAPIREMVCFVLEQNGYQPIEADDYDAAIARLVEPFPDLVLLDWMIPGGSGIQVIKHMKRDSQLREIPVMMLTARGEEEDRVKGLETGADDYLTKPFSPKELVARVKAILRRISPMAADDLIAMNGLTLDPASHRVTSNENPLEMGPTEFKLLHFFMTHPERVYSREQLLNYVWGENVYVEDRTVDVHIRRLRKALEADGHDKMIQTVRGTGYRFSVRY

Flanking regions ( +/- flanking 50bp)

AATCGCGGCACTGTCTGATGAAATGAAATTAACGGTAAACAGGGAACGCCATGGCAAGACGAATTTTAGTCGTTGAAGATGAAGCACCTATCCGTGAAATGGTCTGTTTTGTACTGGAGCAGAATGGCTATCAGCCTATCGAGGCGGATGATTATGATGCGGCCATTGCCCGGCTGGTGGAGCCTTTCCCTGATCTTGTCCTGCTGGACTGGATGATCCCGGGCGGTTCCGGTATTCAGGTTATCAAACATATGAAACGGGACAGTCAGTTGCGGGAAATCCCGGTGATGATGCTGACAGCGCGCGGTGAAGAGGAAGACCGTGTCAAAGGTCTGGAAACCGGCGCGGATGATTATCTGACCAAACCCTTCTCACCGAAAGAGTTAGTGGCCCGTGTTAAAGCGATTCTGCGGCGCATCTCCCCGATGGCGGCGGATGACCTTATCGCCATGAACGGCCTGACACTCGACCCGGCATCCCACCGCGTAACCAGTAATGAGAACCCGCTGGAAATGGGGCCGACCGAATTCAAACTGCTGCACTTCTTTATGACTCATCCGGAGCGGGTTTACAGCCGTGAACAGCTGCTGAACTATGTCTGGGGGGAAAATGTCTATGTTGAGGACCGCACGGTGGATGTGCATATCCGCCGCCTGCGCAAGGCGCTGGAAGCGGACGGACACGATAAAATGATACAGACAGTCCGGGGAACGGGTTACCGCTTCTCTGTCCGTTACTGATAATAATGTTAAACCGCAAGAGGATCGCGCGTGCTTGAGCGTCTTTCGTG