Homologs in group_2114

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15890 FBDBKF_15890 100.0 Morganella morganii S1 hupB nucleoid-associated protein HU-beta
EHELCC_18490 EHELCC_18490 100.0 Morganella morganii S2 hupB nucleoid-associated protein HU-beta
LHKJJB_17335 LHKJJB_17335 100.0 Morganella morganii S3 hupB nucleoid-associated protein HU-beta
HKOGLL_17060 HKOGLL_17060 100.0 Morganella morganii S5 hupB nucleoid-associated protein HU-beta
F4V73_RS16425 F4V73_RS16425 92.3 Morganella psychrotolerans hupB nucleoid-associated protein HU-beta
PMI_RS00570 PMI_RS00570 79.1 Proteus mirabilis HI4320 hupB nucleoid-associated protein HU-beta

Distribution of the homologs in the orthogroup group_2114

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2114

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52681 1.75e-49 154 86 0 90 3 hupB DNA-binding protein HU-beta Serratia marcescens
P0ACF7 1.98e-48 151 86 0 90 3 hupB DNA-binding protein HU-beta Shigella flexneri
P0ACF4 1.98e-48 151 86 0 90 1 hupB DNA-binding protein HU-beta Escherichia coli (strain K12)
P0ACF5 1.98e-48 151 86 0 90 3 hupB DNA-binding protein HU-beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF6 1.98e-48 151 86 0 90 3 hupB DNA-binding protein HU-beta Escherichia coli O157:H7
P0A1R8 4.92e-48 150 85 0 90 3 hupB DNA-binding protein HU-beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R9 4.92e-48 150 85 0 90 3 hupB DNA-binding protein HU-beta Salmonella typhi
P05384 2.29e-41 133 75 0 90 1 hupB DNA-binding protein HU-beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KQS9 5.62e-41 132 72 0 90 3 hupB DNA-binding protein HU-beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KHS6 6.02e-37 122 68 0 90 3 hupB DNA-binding protein HU-beta Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9LA96 6.5e-35 117 69 0 89 3 hupA DNA-binding protein HU-alpha Aeromonas hydrophila
P0ACF3 6.64e-34 115 64 0 89 3 hupA DNA-binding protein HU-alpha Shigella flexneri
E0J6W8 6.64e-34 115 64 0 89 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0ACF0 6.64e-34 115 64 0 89 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain K12)
P0ACF1 6.64e-34 115 64 0 89 3 hupA DNA-binding protein HU-alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF2 6.64e-34 115 64 0 89 3 hupA DNA-binding protein HU-alpha Escherichia coli O157:H7
P52680 9.42e-34 114 64 0 89 3 hupA DNA-binding protein HU-alpha Serratia marcescens
P0A1R6 2.05e-33 113 64 0 89 3 hupA DNA-binding protein HU-alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R7 2.05e-33 113 64 0 89 3 hupA DNA-binding protein HU-alpha Salmonella typhi
P64389 3.81e-33 112 64 0 89 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64388 3.81e-33 112 64 0 89 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q87E48 3.86e-33 113 59 0 89 3 hup DNA-binding protein HU Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P28080 3.92e-33 112 65 0 89 3 hupA DNA-binding protein HU-alpha Vibrio proteolyticus
Q7A0U9 8.34e-32 109 58 0 89 3 hup DNA-binding protein HU Staphylococcus aureus (strain MW2)
Q6G990 8.34e-32 109 58 0 89 3 hup DNA-binding protein HU Staphylococcus aureus (strain MSSA476)
Q6GGT8 8.34e-32 109 58 0 89 3 hup DNA-binding protein HU Staphylococcus aureus (strain MRSA252)
Q7A5J1 8.34e-32 109 58 0 89 1 hup DNA-binding protein HU Staphylococcus aureus (strain N315)
Q99U17 8.34e-32 109 58 0 89 1 hup DNA-binding protein HU Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFV0 8.34e-32 109 58 0 89 3 hup DNA-binding protein HU Staphylococcus aureus (strain COL)
Q9PE38 9.77e-32 109 58 0 89 3 hup DNA-binding protein HU Xylella fastidiosa (strain 9a5c)
Q9KV83 1.47e-31 108 60 0 89 3 hupA DNA-binding protein HU-alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A3H0 2.63e-31 108 55 0 89 1 hup DNA-binding protein HU Geobacillus stearothermophilus
P0A3H1 2.63e-31 108 55 0 89 1 hup DNA-binding protein HU Bacillus caldolyticus
P0A3H2 2.63e-31 108 55 0 89 3 hup DNA-binding protein HU Bacillus caldotenax
P08821 5.1e-31 107 52 0 91 1 hbs DNA-binding protein HU 1 Bacillus subtilis (strain 168)
P43722 1.38e-30 106 59 0 89 3 hup DNA-binding protein HU Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KDA5 2.72e-30 105 56 0 90 3 hup1 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9CK94 4.17e-30 105 59 0 89 3 hup DNA-binding protein HU Pasteurella multocida (strain Pm70)
P57144 5.68e-30 105 52 0 89 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9K7K5 3.98e-29 102 53 0 89 3 hup2 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9XB21 8.91e-29 102 54 0 90 1 hup DNA-binding protein HU Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8KA69 1.18e-28 101 52 0 89 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9JR30 2.24e-28 100 54 0 91 3 hupB2 DNA-binding protein HU-beta 2 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P96045 4.36e-28 100 53 0 90 3 hup DNA-binding protein HU Streptococcus thermophilus
Q9XB22 5.67e-28 100 54 0 90 3 hup DNA-binding protein HU Streptococcus downei
P0C0H2 1.61e-27 99 53 0 90 3 hup DNA-binding protein HU Streptococcus pyogenes
P0DB65 1.61e-27 99 53 0 90 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain SSI-1)
P0C097 1.61e-27 99 53 0 90 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB35 1.61e-27 99 53 0 90 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DB64 1.61e-27 99 53 0 90 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0H3 1.61e-27 99 53 0 90 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M1
P68574 1.41e-26 96 47 0 90 3 hup2 DNA-binding protein HU 2 Bacillus phage SPbeta
P68573 1.41e-26 96 47 0 90 3 hup2 SPbeta prophage-derived DNA-binding protein HU 2 Bacillus subtilis (strain 168)
P05385 1.73e-26 96 52 0 90 1 hup DNA-binding protein HU Clostridium pasteurianum
Q9XB20 2.2e-26 95 57 0 90 3 hup DNA-binding protein HU Streptococcus gordonii
Q9CI64 1.04e-25 94 53 0 90 1 hup DNA-binding protein HU Lactococcus lactis subsp. lactis (strain IL1403)
Q89B22 2.25e-25 93 49 0 89 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P02344 8.36e-25 92 53 0 90 1 hupB DNA-binding protein HRm Rhizobium meliloti (strain 1021)
P0DMK4 2.73e-24 90 51 0 90 3 hupA DNA-binding protein HU-alpha Burkholderia pseudomallei (strain K96243)
I1WEI8 2.73e-24 90 51 0 90 3 hupA DNA-binding protein HU-alpha Burkholderia pseudomallei (strain 1026b)
P02348 3.93e-24 90 51 0 91 1 None DNA-binding protein HRL53 Rhizobium leguminosarum
Q9HTL0 3.81e-23 87 47 0 90 3 hupA DNA-binding protein HU-alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8GX11 7.87e-22 84 50 0 91 3 hup DNA-binding protein HU Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAV2 7.87e-22 84 50 0 91 3 hup DNA-binding protein HU Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A8IN83 1.62e-21 83 43 1 90 3 ihfB Integration host factor subunit beta Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P05514 2.1e-21 83 43 0 89 1 hup DNA-binding protein HU Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P29214 4.75e-21 82 40 0 90 3 hup DNA-binding protein HU homolog Guillardia theta
Q5HUP6 5.26e-21 82 44 0 89 3 hup DNA-binding protein HU Campylobacter jejuni (strain RM1221)
Q46121 5.26e-21 82 44 0 89 1 hup DNA-binding protein HU Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P0A3H4 8.03e-21 82 52 0 90 1 None DNA-binding protein HRL18 Rhizobium radiobacter
P0A3H3 8.03e-21 82 52 0 90 1 None DNA-binding protein HRL18 Rhizobium leguminosarum
Q9ZDZ2 1.24e-20 81 45 0 83 3 hup DNA-binding protein HU Rickettsia prowazekii (strain Madrid E)
Q68XJ6 1.98e-20 81 40 1 99 3 hup DNA-binding protein HU Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92J57 8.1e-20 79 36 1 99 3 hup DNA-binding protein HU Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4UKH2 1.9e-19 78 36 1 99 3 hup DNA-binding protein HU Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q0ATJ4 2.28e-19 78 40 1 89 3 ihfB Integration host factor subunit beta Maricaulis maris (strain MCS10)
Q28LB0 2.37e-19 78 40 1 90 3 ihfB Integration host factor subunit beta Jannaschia sp. (strain CCS1)
Q608S8 2.82e-19 78 35 1 91 3 ihfB Integration host factor subunit beta Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1GK81 3.78e-19 77 38 1 90 3 ihfB Integration host factor subunit beta Ruegeria sp. (strain TM1040)
P19436 4.08e-19 77 44 0 90 1 TTHA1349 DNA-binding protein HU Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5LV98 5.64e-19 77 40 1 90 3 ihfB Integration host factor subunit beta Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A7IHH0 6.15e-19 77 41 1 89 3 ihfB Integration host factor subunit beta Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A7HBJ3 1.09e-18 76 35 0 90 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain Fw109-5)
P0A3I1 1.45e-18 76 43 1 89 3 ihfB Integration host factor subunit beta Rhizobium radiobacter
P0A3I2 1.45e-18 76 43 1 89 3 ihfB Integration host factor subunit beta Agrobacterium tumefaciens (strain 15955)
B4UAP1 1.71e-18 76 35 0 91 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain K)
B8J836 1.71e-18 76 35 0 91 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IJA7 1.97e-18 76 35 0 91 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-C)
Q1D6D8 2.27e-18 76 37 0 91 3 ihfA Integration host factor subunit alpha Myxococcus xanthus (strain DK1622)
Q9K4Q3 2.27e-18 76 37 0 91 3 ihfA Integration host factor subunit alpha Myxococcus xanthus
Q161H6 2.6e-18 75 40 1 90 3 ihfB Integration host factor subunit beta Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
P36206 3.21e-18 75 44 0 90 1 hup DNA-binding protein HU Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A8LSF5 4.17e-18 75 39 2 91 3 ihfB Integration host factor subunit beta Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q44654 6.98e-18 74 38 1 91 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B9KU92 9.38e-18 74 38 1 89 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PPV4 9.38e-18 74 38 1 89 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B4ET28 9.99e-18 74 35 1 91 3 ihfB Integration host factor subunit beta Proteus mirabilis (strain HI4320)
Q9X4E2 1e-17 73 38 1 89 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A1TZF1 1.31e-17 73 40 1 91 3 ihfB Integration host factor subunit beta Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B8D7K1 1.36e-17 73 39 1 89 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57394 1.36e-17 73 39 1 89 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D999 1.36e-17 73 39 1 89 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A3QEC3 1.37e-17 73 35 1 91 3 ihfB Integration host factor subunit beta Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TT46 1.8e-17 73 35 1 91 3 ihfB Integration host factor subunit beta Shewanella halifaxensis (strain HAW-EB4)
A6W0A0 2.18e-17 73 35 1 91 3 ihfB Integration host factor subunit beta Marinomonas sp. (strain MWYL1)
A8H4A7 2.5e-17 73 35 1 91 3 ihfB Integration host factor subunit beta Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9RNZ5 3e-17 73 32 0 89 3 ihfA Integration host factor subunit alpha Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q12ND8 3.24e-17 72 37 2 94 3 ihfB Integration host factor subunit beta Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q98GS0 3.3e-17 72 41 1 90 3 ihfB Integration host factor subunit beta Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A1B8K9 5.24e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Paracoccus denitrificans (strain Pd 1222)
Q2SCF7 5.54e-17 72 39 1 91 3 ihfB Integration host factor subunit beta Hahella chejuensis (strain KCTC 2396)
Q13EQ5 5.73e-17 72 38 1 89 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB5)
B1KF50 5.91e-17 72 35 1 91 3 ihfB Integration host factor subunit beta Shewanella woodyi (strain ATCC 51908 / MS32)
A1RJG1 5.91e-17 72 36 2 94 3 ihfB Integration host factor subunit beta Shewanella sp. (strain W3-18-1)
A4Y729 5.91e-17 72 36 2 94 3 ihfB Integration host factor subunit beta Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q87AB7 5.94e-17 72 36 0 90 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5D7 5.94e-17 72 36 0 90 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M12)
B2I9P2 5.94e-17 72 36 0 90 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M23)
Q482G2 6.45e-17 72 34 1 91 3 ihfB Integration host factor subunit beta Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q2J2G1 6.97e-17 72 38 1 89 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain HaA2)
P0A3H8 8.06e-17 74 42 1 91 3 hup2 DNA-binding protein HU 2 Streptomyces lividans
P0A3H7 8.06e-17 74 42 1 91 1 hup2 DNA-binding protein HU 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A7HPD7 8.39e-17 72 38 1 90 3 ihfB Integration host factor subunit beta Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B0UUH4 8.81e-17 71 35 1 91 3 ihfB Integration host factor subunit beta Histophilus somni (strain 2336)
Q0I390 8.81e-17 71 35 1 91 3 ihfB Integration host factor subunit beta Histophilus somni (strain 129Pt)
Q11C35 9e-17 71 39 1 89 3 ihfB Integration host factor subunit beta Chelativorans sp. (strain BNC1)
B6JCN9 9.02e-17 72 37 1 89 3 ihfB Integration host factor subunit beta Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B9JZH2 9.53e-17 72 38 1 89 3 ihfB Integration host factor subunit beta Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B3Q602 1.09e-16 71 38 1 89 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain TIE-1)
Q6NDN9 1.09e-16 71 38 1 89 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q06607 1.23e-16 71 37 1 90 1 ihfB Integration host factor subunit beta Rhodobacter capsulatus
P73418 1.24e-16 71 41 2 95 3 hup DNA-binding protein HU Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8G304 1.32e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Brucella suis biovar 1 (strain 1330)
B0CIR1 1.32e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VN89 1.32e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M798 1.32e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A6WV92 1.32e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q57FM3 1.42e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Brucella abortus biovar 1 (strain 9-941)
Q2YP18 1.42e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Brucella abortus (strain 2308)
B2S8E6 1.42e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Brucella abortus (strain S19)
C5BSK5 1.53e-16 71 36 1 91 3 ihfB Integration host factor subunit beta Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8UIF9 1.62e-16 71 37 1 89 3 ihfB Integration host factor subunit beta Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1RHD4 1.74e-16 71 42 0 76 3 hup DNA-binding protein HU Rickettsia bellii (strain RML369-C)
A8FVN3 1.82e-16 70 35 1 91 3 ihfB Integration host factor subunit beta Shewanella sediminis (strain HAW-EB3)
Q1QS30 1.88e-16 71 37 1 89 3 ihfB Integration host factor subunit beta Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q07UH4 1.93e-16 71 37 1 89 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisA53)
Q0HV14 1.94e-16 70 36 2 94 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-7)
Q0HIW8 1.94e-16 70 36 2 94 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-4)
A0KWP0 1.94e-16 70 36 2 94 3 ihfB Integration host factor subunit beta Shewanella sp. (strain ANA-3)
Q8EEI1 1.94e-16 70 36 2 94 3 ihfB Integration host factor subunit beta Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8EMZ0 2.1e-16 70 37 1 90 3 ihfB Integration host factor subunit beta Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B5XY84 2.16e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae (strain 342)
A5EWQ2 2.22e-16 70 34 2 96 3 ihfB Integration host factor subunit beta Dichelobacter nodosus (strain VCS1703A)
Q2RXP8 2.25e-16 70 38 1 92 3 ihfB Integration host factor subunit beta Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B2IKV6 2.33e-16 70 38 1 89 3 ihfB Integration host factor subunit beta Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q1ID97 2.33e-16 70 35 1 91 3 ihfB Integration host factor subunit beta Pseudomonas entomophila (strain L48)
Q21YS7 2.39e-16 70 38 0 93 3 ihfA Integration host factor subunit alpha Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9MHX0 2.51e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6T704 2.52e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MUP0 2.68e-16 70 32 1 91 3 ihfB Integration host factor subunit beta Vibrio campbellii (strain ATCC BAA-1116)
A5UBN4 2.71e-16 70 37 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittEE)
Q4QJU8 2.71e-16 70 37 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain 86-028NP)
Q87N46 2.76e-16 70 32 1 91 3 ihfB Integration host factor subunit beta Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8YET3 2.8e-16 70 38 1 90 3 ihfB Integration host factor subunit beta Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RGK7 2.8e-16 70 38 1 90 3 ihfB Integration host factor subunit beta Brucella melitensis biotype 2 (strain ATCC 23457)
A1S6D6 3.42e-16 70 35 2 94 3 ihfB Integration host factor subunit beta Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q3SWL5 3.61e-16 70 37 1 89 3 ihfB Integration host factor subunit beta Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q3IL99 3.69e-16 70 36 1 91 3 ihfB Integration host factor subunit beta Pseudoalteromonas translucida (strain TAC 125)
Q12BQ7 3.73e-16 70 37 0 91 3 ihfA Integration host factor subunit alpha Polaromonas sp. (strain JS666 / ATCC BAA-500)
P64394 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64395 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella typhi
B4TRU3 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella schwarzengrund (strain CVM19633)
B5BBP5 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella paratyphi A (strain AKU_12601)
C0PXU8 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella paratyphi C (strain RKS4594)
A9N7V2 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGG9 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T146 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella newport (strain SL254)
B4TD42 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella heidelberg (strain SL476)
B5R8J9 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZB6 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella enteritidis PT4 (strain P125109)
B5FQ55 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella dublin (strain CT_02021853)
Q57R19 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella choleraesuis (strain SC-B67)
B5F165 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Salmonella agona (strain SL483)
A8AIH1 3.79e-16 70 34 1 91 3 ihfB Integration host factor subunit beta Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q081U7 3.98e-16 70 36 2 94 3 ihfB Integration host factor subunit beta Shewanella frigidimarina (strain NCIMB 400)
Q2RTS7 3.99e-16 70 33 0 90 3 ihfA Integration host factor subunit alpha Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q65SH8 4.05e-16 70 35 1 91 3 ihfB Integration host factor subunit beta Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8D8J3 4.08e-16 70 32 1 91 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain CMCP6)
B7VH32 4.19e-16 70 32 1 91 3 ihfB Integration host factor subunit beta Vibrio atlanticus (strain LGP32)
Q92SJ7 4.42e-16 70 37 1 89 3 ihfB Integration host factor subunit beta Rhizobium meliloti (strain 1021)
A6U5F1 4.98e-16 70 37 1 89 3 ihfB Integration host factor subunit beta Sinorhizobium medicae (strain WSM419)
B5ZN05 5.13e-16 70 37 1 89 3 ihfB Integration host factor subunit beta Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MM94 5.13e-16 70 37 1 89 3 ihfB Integration host factor subunit beta Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2KD65 5.13e-16 70 37 1 89 3 ihfB Integration host factor subunit beta Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PZE1 5.13e-16 70 37 1 89 3 ihfB Integration host factor subunit beta Rhizobium etli (strain CIAT 652)
Q9PFD5 5.78e-16 69 35 0 90 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain 9a5c)
A9L2X4 6.79e-16 69 36 2 94 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS195)
A6WNM7 6.79e-16 69 36 2 94 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS185)
A3D4A9 6.79e-16 69 36 2 94 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA98 6.79e-16 69 36 2 94 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS223)
A6VPK8 6.98e-16 69 36 1 91 3 ihfB Integration host factor subunit beta Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A9IL25 7.24e-16 69 38 1 89 3 ihfB Integration host factor subunit beta Bartonella tribocorum (strain CIP 105476 / IBS 506)
A1WUI6 7.76e-16 69 32 1 92 3 ihfB Integration host factor subunit beta Halorhodospira halophila (strain DSM 244 / SL1)
A9C3C8 8.14e-16 69 37 0 90 3 ihfA Integration host factor subunit alpha Delftia acidovorans (strain DSM 14801 / SPH-1)
P43724 8.22e-16 69 36 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4W8T1 8.35e-16 69 34 1 91 3 ihfB Integration host factor subunit beta Enterobacter sp. (strain 638)
A7INL3 8.64e-16 69 32 0 91 3 ihfA Integration host factor subunit alpha Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q47GF4 9.03e-16 69 34 0 91 3 ihfA1 Integration host factor subunit alpha 1 Dechloromonas aromatica (strain RCB)
B9J885 9.03e-16 69 37 1 89 3 ihfB Integration host factor subunit beta Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B1J5H2 9.51e-16 69 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain W619)
Q5GXY6 9.54e-16 69 35 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P101 9.54e-16 69 35 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRU3 9.54e-16 69 35 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P0A0T9 9.54e-16 69 35 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRH5 9.54e-16 69 35 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain B100)
Q4UW51 9.54e-16 69 35 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain 8004)
P0A0U0 9.54e-16 69 35 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas axonopodis pv. citri (strain 306)
B6IUP4 9.75e-16 68 35 1 91 3 ihfB Integration host factor subunit beta Rhodospirillum centenum (strain ATCC 51521 / SW)
C3LNL8 9.82e-16 68 31 1 91 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain M66-2)
Q9KQT4 9.82e-16 68 31 1 91 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6Y4 9.82e-16 68 31 1 91 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4YJI9 1.11e-15 69 37 1 89 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain ORS 278)
Q89WE8 1.25e-15 68 37 1 89 3 ihfB Integration host factor subunit beta Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7N6D2 1.33e-15 68 35 1 91 3 ihfB Integration host factor subunit beta Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4XTF3 1.33e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas mendocina (strain ymp)
A5UF83 1.36e-15 68 36 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittGG)
Q2SDJ8 1.42e-15 68 35 0 93 3 ihfA Integration host factor subunit alpha Hahella chejuensis (strain KCTC 2396)
Q6LPE4 1.43e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Photobacterium profundum (strain SS9)
Q3Z3K9 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Shigella sonnei (strain Ss046)
P0A6Y4 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Shigella flexneri
Q0SX03 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Shigella flexneri serotype 5b (strain 8401)
Q32E32 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Shigella dysenteriae serotype 1 (strain Sd197)
Q31YT8 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Shigella boydii serotype 4 (strain Sb227)
B2TUG9 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDU6 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli (strain UTI89 / UPEC)
B1LJV1 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Y4 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli (strain SE11)
B7NAR1 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6Y1 1.47e-15 68 32 1 91 1 ihfB Integration host factor subunit beta Escherichia coli (strain K12)
B1IW19 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6Y2 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJE1 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZYL5 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O9:H4 (strain HS)
B1X852 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / DH10B)
C4ZQ38 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / MC4100 / BW2952)
B7M841 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O8 (strain IAI1)
B7MS27 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O81 (strain ED1a)
B7NM62 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT46 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6Y3 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7
B7LDA4 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli (strain 55989 / EAEC)
B7MHM1 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZK01 1.47e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O139:H28 (strain E24377A / ETEC)
B2FN73 1.49e-15 68 35 0 92 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain K279a)
B4SQG8 1.49e-15 68 35 0 92 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain R551-3)
Q7MLX5 1.49e-15 68 31 1 91 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain YJ016)
Q1QWK1 1.56e-15 68 36 0 90 3 ihfA Integration host factor subunit alpha Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B8F475 1.58e-15 68 35 1 91 3 ihfB Integration host factor subunit beta Glaesserella parasuis serovar 5 (strain SH0165)
Q6F874 1.63e-15 68 32 0 92 3 ihfA Integration host factor subunit alpha Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B7LN74 1.69e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4SLS6 1.71e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Aeromonas salmonicida (strain A449)
P37983 1.74e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Dickeya dadantii (strain 3937)
Q1QVK5 1.75e-15 68 37 1 91 3 ihfB Integration host factor subunit beta Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q21CB6 1.77e-15 68 37 1 89 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB18)
A0KJ94 1.86e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B0V5Q4 2.13e-15 68 32 0 92 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AYE)
A3M2B0 2.13e-15 68 32 0 92 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VV83 2.13e-15 68 32 0 92 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain SDF)
B2HTI2 2.13e-15 68 32 0 92 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain ACICU)
B7I698 2.13e-15 68 32 0 92 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AB0057)
B7GZZ4 2.13e-15 68 32 0 92 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AB307-0294)
Q6MMJ0 2.26e-15 68 36 0 91 3 ihfA Integration host factor subunit alpha Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A5E8A7 2.26e-15 68 37 1 89 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A9H0B5 2.32e-15 68 39 1 91 3 ihfB Integration host factor subunit beta Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B2VC76 2.37e-15 68 32 1 91 3 ihfB Integration host factor subunit beta Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q51473 2.42e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PW7 2.42e-15 68 34 1 91 1 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VAL8 2.42e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain LESB58)
A6V2R4 2.42e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain PA7)
P0A129 2.52e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas putida
P0A128 2.52e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q21IT4 2.73e-15 68 34 1 91 3 ihfB Integration host factor subunit beta Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C1DRR5 2.92e-15 67 34 1 91 3 ihfB Integration host factor subunit beta Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1GZS3 3.07e-15 67 35 0 92 3 ihfA Integration host factor subunit alpha Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B7UMZ8 3.28e-15 67 32 1 91 3 ihfB Integration host factor subunit beta Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B0KTY3 3.51e-15 67 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain GB-1)
A5W7F5 3.51e-15 67 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q21KD4 3.74e-15 67 36 0 86 3 ihfA Integration host factor subunit alpha Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B8GRI6 3.84e-15 67 34 0 92 3 ihfA Integration host factor subunit alpha Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A4WTU0 3.9e-15 67 32 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J366 3.9e-15 67 32 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PJ63 3.9e-15 67 32 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A1U2B7 4.21e-15 67 33 0 93 3 ihfA Integration host factor subunit alpha Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q2W4R6 4.24e-15 67 33 0 90 3 ihfA Integration host factor subunit alpha Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B1KRE5 4.35e-15 67 34 0 91 3 ihfA Integration host factor subunit alpha Shewanella woodyi (strain ATCC 51908 / MS32)
A3QF32 4.66e-15 67 34 0 91 3 ihfA Integration host factor subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8LLT5 4.91e-15 67 32 0 89 3 ihfA Integration host factor subunit alpha Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q0AA51 4.95e-15 67 31 1 91 3 ihfB Integration host factor subunit beta Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q15T07 4.99e-15 67 31 1 91 3 ihfB Integration host factor subunit beta Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q083K5 5.16e-15 67 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella frigidimarina (strain NCIMB 400)
Q5QZ46 5.16e-15 67 32 0 90 3 ihfB Integration host factor subunit beta Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1GI70 5.23e-15 67 31 0 89 3 ihfA Integration host factor subunit alpha Ruegeria sp. (strain TM1040)
Q3K8V7 5.31e-15 67 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas fluorescens (strain Pf0-1)
Q48FN3 5.61e-15 67 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C6DF68 5.84e-15 67 32 1 91 3 ihfB Integration host factor subunit beta Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D404 5.84e-15 67 32 1 91 3 ihfB Integration host factor subunit beta Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q15SX9 5.92e-15 67 33 0 92 3 ihfA Integration host factor subunit alpha Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q0ADP0 6.4e-15 67 35 0 89 3 ihfA Integration host factor subunit alpha Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q4ZQ99 6.46e-15 67 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas syringae pv. syringae (strain B728a)
Q885T0 6.46e-15 67 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q07MS0 6.46e-15 67 32 0 91 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisA53)
A1B366 6.54e-15 67 31 0 89 3 ihfA Integration host factor subunit alpha Paracoccus denitrificans (strain Pd 1222)
B4ETL2 6.67e-15 67 36 0 91 3 ihfA Integration host factor subunit alpha Proteus mirabilis (strain HI4320)
Q65TL4 6.97e-15 67 34 0 88 3 ihfA Integration host factor subunit alpha Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C3K6K2 7.12e-15 67 34 1 91 3 ihfB Integration host factor subunit beta Pseudomonas fluorescens (strain SBW25)
C5BBR9 7.18e-15 67 31 1 91 3 ihfB Integration host factor subunit beta Edwardsiella ictaluri (strain 93-146)
Q60AY8 7.22e-15 67 35 0 92 3 ihfA Integration host factor subunit alpha Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q47ZS6 7.26e-15 67 35 0 90 3 ihfA Integration host factor subunit alpha Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B5FG57 7.64e-15 66 31 1 91 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain MJ11)
Q5E3Z3 7.64e-15 66 31 1 91 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain ATCC 700601 / ES114)
P95519 7.81e-15 66 31 1 91 3 ihfB Integration host factor subunit beta Mannheimia haemolytica
Q3SK28 8.15e-15 67 35 0 94 3 ihfA Integration host factor subunit alpha Thiobacillus denitrificans (strain ATCC 25259)
Q2NUA6 8.19e-15 66 32 1 91 3 ihfB Integration host factor subunit beta Sodalis glossinidius (strain morsitans)
C4LF00 8.8e-15 66 31 1 92 3 ihfB Integration host factor subunit beta Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q47CN0 9.83e-15 66 35 0 92 3 ihfA2 Integration host factor subunit alpha 2 Dechloromonas aromatica (strain RCB)
A1K4E7 1.06e-14 66 35 0 92 3 ihfA Integration host factor subunit alpha Azoarcus sp. (strain BH72)
B0UU60 1.18e-14 66 37 0 77 3 ihfA Integration host factor subunit alpha Histophilus somni (strain 2336)
Q0I3K4 1.18e-14 66 37 0 77 3 ihfA Integration host factor subunit alpha Histophilus somni (strain 129Pt)
Q82VV7 1.37e-14 66 35 0 91 3 ihfA Integration host factor subunit alpha Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A5EKG4 1.4e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A8FWI0 1.49e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella sediminis (strain HAW-EB3)
B8CR59 1.49e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H5F1 1.49e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TQY4 1.49e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella halifaxensis (strain HAW-EB4)
Q9CML8 1.52e-14 65 31 1 91 3 ihfB Integration host factor subunit beta Pasteurella multocida (strain Pm70)
A1S700 1.53e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q7VLR8 1.55e-14 65 36 1 91 3 ihfB Integration host factor subunit beta Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B1ZKI7 1.57e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B6EIY1 1.6e-14 65 30 1 91 3 ihfB Integration host factor subunit beta Aliivibrio salmonicida (strain LFI1238)
A4YW83 1.66e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Bradyrhizobium sp. (strain ORS 278)
B5FDX6 1.8e-14 65 34 0 90 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain MJ11)
Q5E5G4 1.8e-14 65 34 0 90 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EN06 1.94e-14 65 34 0 90 3 ihfA Integration host factor subunit alpha Aliivibrio salmonicida (strain LFI1238)
A1VR71 1.95e-14 66 34 0 91 3 ihfA Integration host factor subunit alpha Polaromonas naphthalenivorans (strain CJ2)
Q7W7C5 1.95e-14 66 37 0 90 3 ihfA Integration host factor subunit alpha Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKR3 1.95e-14 66 37 0 90 3 ihfA Integration host factor subunit alpha Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B8H6A5 1.97e-14 65 37 1 89 3 ihfB Integration host factor subunit beta Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A2H5 1.97e-14 65 37 1 89 3 ihfB Integration host factor subunit beta Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7VVR6 1.98e-14 66 37 0 90 3 ihfA Integration host factor subunit alpha Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q1QMY9 2.03e-14 66 32 0 91 3 ihfA Integration host factor subunit alpha Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4VM16 2.06e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Stutzerimonas stutzeri (strain A1501)
Q7NYC0 2.08e-14 65 34 0 92 3 ihfA Integration host factor subunit alpha Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9F297 2.1e-14 65 35 1 85 3 ihfA Integration host factor subunit alpha (Fragment) Neisseria gonorrhoeae
A5EXT4 2.16e-14 65 37 0 88 3 ihfA Integration host factor subunit alpha Dichelobacter nodosus (strain VCS1703A)
Q5LQJ4 2.25e-14 65 30 0 89 3 ihfA Integration host factor subunit alpha Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q057Y8 2.27e-14 65 33 0 93 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Cinara cedri (strain Cc)
P23303 2.38e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Serratia marcescens
Q12NT8 2.47e-14 65 31 0 91 3 ihfA Integration host factor subunit alpha Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q7N3Q2 2.54e-14 65 36 0 91 3 ihfA Integration host factor subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8I5K8 2.59e-14 65 30 0 91 3 ihfA Integration host factor subunit alpha Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B7VPF6 2.84e-14 65 37 0 86 3 ihfA Integration host factor subunit alpha Vibrio atlanticus (strain LGP32)
B1J6V0 2.85e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain W619)
P0A127 2.85e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida
P0A126 2.85e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKR2 2.85e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain GB-1)
A5W5D5 2.85e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A1WU59 2.96e-14 65 31 0 91 3 ihfA Integration host factor subunit alpha Halorhodospira halophila (strain DSM 244 / SL1)
A1KSZ1 3.25e-14 65 35 1 85 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P64393 3.25e-14 65 35 1 85 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64392 3.25e-14 65 35 1 85 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M383 3.25e-14 65 35 1 85 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup C (strain 053442)
Q1IC09 3.39e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas entomophila (strain L48)
Q4ZUG1 3.58e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas syringae pv. syringae (strain B728a)
Q883H6 3.58e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KEX6 3.58e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain Pf0-1)
C3JZN1 3.58e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain SBW25)
Q4KEV8 3.58e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48JR7 3.58e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q51472 3.62e-14 65 32 0 90 1 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NN5 3.62e-14 65 32 0 90 1 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V491 3.62e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain PA7)
Q057N8 3.71e-14 65 33 1 90 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q0HUQ0 3.89e-14 65 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain MR-7)
Q0HJ83 3.89e-14 65 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain MR-4)
A1K4D5 4.01e-14 65 34 1 91 3 ihfB Integration host factor subunit beta Azoarcus sp. (strain BH72)
Q8EF98 4.06e-14 65 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0AAM1 4.18e-14 65 32 0 92 3 ihfA Integration host factor subunit alpha Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5P7Y1 4.49e-14 65 34 0 92 3 ihfA Integration host factor subunit alpha Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0VNG4 4.55e-14 65 33 0 90 3 ihfA Integration host factor subunit alpha Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
P30787 4.7e-14 65 30 0 89 1 ihfA Integration host factor subunit alpha Rhodobacter capsulatus
A0KWC7 4.73e-14 64 32 0 91 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain ANA-3)
A8GCH4 4.77e-14 64 31 1 91 3 ihfB Integration host factor subunit beta Serratia proteamaculans (strain 568)
B7V312 4.91e-14 64 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain LESB58)
A0KKP3 5.44e-14 64 34 0 86 3 ihfA Integration host factor subunit alpha Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q2YBS0 5.49e-14 64 36 0 91 3 ihfA Integration host factor subunit alpha Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q214G0 5.59e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisB18)
A1JMJ0 5.62e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q83C16 5.89e-14 64 37 0 89 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N8J9 5.89e-14 64 37 0 89 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KGB5 5.89e-14 64 37 0 89 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain Dugway 5J108-111)
B6IZG2 5.89e-14 64 37 0 89 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain CbuG_Q212)
B6J7X5 5.89e-14 64 37 0 89 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain CbuK_Q154)
A4XTS7 6.04e-14 64 32 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas mendocina (strain ymp)
A5VC87 6.17e-14 64 31 0 89 3 ihfA Integration host factor subunit alpha Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q2IWQ7 6.92e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain HaA2)
Q5ZS10 6.93e-14 64 32 1 94 3 ihfA Integration host factor subunit alpha Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q136S3 6.99e-14 65 32 0 90 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisB5)
Q5WT88 7.12e-14 64 31 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Lens)
A5IAL5 7.12e-14 64 31 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Corby)
Q5X1H9 7.12e-14 64 31 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Paris)
B1JRD6 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CI5 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TN15 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pestis (strain Pestoides F)
Q1CGG8 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7I5 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGB1 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pestis
B2KA26 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CA70 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJW6 7.29e-14 64 30 1 91 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B0T273 7.29e-14 64 35 1 89 3 ihfB Integration host factor subunit beta Caulobacter sp. (strain K31)
B3QJM1 7.57e-14 64 32 0 90 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain TIE-1)
Q6N676 7.57e-14 64 32 0 90 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A4VMF7 7.68e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Stutzerimonas stutzeri (strain A1501)
Q1GT91 7.77e-14 64 31 0 91 3 ihfA Integration host factor subunit alpha Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q3SSS2 8.05e-14 64 32 0 90 3 ihfA Integration host factor subunit alpha Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
P37982 8.81e-14 64 34 0 91 3 ihfA Integration host factor subunit alpha Dickeya dadantii (strain 3937)
A1RK12 8.88e-14 64 31 0 91 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain W3-18-1)
A4Y6H0 8.88e-14 64 31 0 91 3 ihfA Integration host factor subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KYZ2 8.88e-14 64 31 0 91 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS195)
A6WMK6 8.88e-14 64 31 0 91 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS185)
A3D3R8 8.88e-14 64 31 0 91 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E7F3 8.88e-14 64 31 0 91 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS223)
C6DFZ2 8.88e-14 64 34 0 91 3 ihfA Integration host factor subunit alpha Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4H4 8.88e-14 64 34 0 91 3 ihfA Integration host factor subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B4RJZ4 9.43e-14 64 35 1 85 3 ihfA Integration host factor subunit alpha Neisseria gonorrhoeae (strain NCCP11945)
Q5F9T5 9.43e-14 64 35 1 85 3 ihfA Integration host factor subunit alpha Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2KZM3 9.46e-14 64 36 0 90 3 ihfA Integration host factor subunit alpha Bordetella avium (strain 197N)
Q0BQI4 9.49e-14 64 36 1 91 3 ihfB Integration host factor subunit beta Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B2VEL2 9.82e-14 63 33 0 93 3 ihfA Integration host factor subunit alpha Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1SUQ7 1.07e-13 63 38 1 86 3 ihfA Integration host factor subunit alpha Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B6JGR8 1.13e-13 64 32 0 90 3 ihfA Integration host factor subunit alpha Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q2NT26 1.15e-13 63 34 0 91 3 ihfA Integration host factor subunit alpha Sodalis glossinidius (strain morsitans)
A6VP80 1.31e-13 63 31 0 91 3 ihfA Integration host factor subunit alpha Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q28RG2 1.33e-13 63 31 0 89 3 ihfA Integration host factor subunit alpha Jannaschia sp. (strain CCS1)
A8GDR1 1.4e-13 63 34 0 91 3 ihfA Integration host factor subunit alpha Serratia proteamaculans (strain 568)
Q8Y0Y3 1.43e-13 64 34 2 98 3 ihfB Integration host factor subunit beta Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P43723 1.49e-13 63 30 0 89 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKM2 1.49e-13 63 30 0 89 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain 86-028NP)
A7MVH4 1.51e-13 63 34 0 88 3 ihfA Integration host factor subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
P23302 1.55e-13 63 34 0 91 3 ihfA Integration host factor subunit alpha Serratia marcescens
Q87Q56 1.56e-13 63 34 0 88 3 ihfA Integration host factor subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B1JJ23 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q9X9F6 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIL7 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pestis (strain Pestoides F)
Q1CIH0 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0A2 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX2 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pestis
B2K662 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C735 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHG7 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JMM4 1.58e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q4FQ67 1.64e-13 63 26 0 93 3 ihfA Integration host factor subunit alpha Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9CN18 1.74e-13 63 30 0 88 3 ihfA Integration host factor subunit alpha Pasteurella multocida (strain Pm70)
A8A0Q4 1.88e-13 63 32 0 93 3 ihfA Integration host factor subunit alpha Escherichia coli O9:H4 (strain HS)
P95516 1.95e-13 63 33 0 92 3 ihfA Integration host factor subunit alpha Mannheimia haemolytica
C3LLR8 1.98e-13 63 34 0 86 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain M66-2)
Q9KSN4 1.98e-13 63 34 0 86 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1W7 1.98e-13 63 34 0 86 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q3JBZ6 2.1e-13 63 32 0 92 3 ihfA Integration host factor subunit alpha Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A9W4E5 2.15e-13 63 31 0 91 3 ihfA Integration host factor subunit alpha Methylorubrum extorquens (strain PA1)
B7KYG6 2.15e-13 63 31 0 91 3 ihfA Integration host factor subunit alpha Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A6VYH5 2.6e-13 63 38 0 90 3 ihfA Integration host factor subunit alpha Marinomonas sp. (strain MWYL1)
P17615 2.65e-13 62 41 0 91 1 hup DNA-binding protein HB1 Bifidobacterium longum (strain NCC 2705)
P0A1S0 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1S1 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella typhi
B4TUF6 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella schwarzengrund (strain CVM19633)
B5BA36 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain AKU_12601)
C0Q640 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella paratyphi C (strain RKS4594)
A9N236 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PH86 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4N4 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella newport (strain SL254)
B4TGH7 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella heidelberg (strain SL476)
B5RAW7 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW2 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella enteritidis PT4 (strain P125109)
B5FJA2 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella dublin (strain CT_02021853)
Q57PU7 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella choleraesuis (strain SC-B67)
B5F7F6 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella agona (strain SL483)
A8AHA5 2.73e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MNY7 2.76e-13 62 32 0 91 3 ihfA Integration host factor subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
Q8XZ23 2.98e-13 63 33 0 93 3 ihfA Integration host factor subunit alpha Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A9MFB7 3.01e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q63S07 3.1e-13 63 32 1 92 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain K96243)
A3NC29 3.1e-13 63 32 1 92 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 668)
Q3JPY2 3.1e-13 63 32 1 92 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 1710b)
A3NXW8 3.1e-13 63 32 1 92 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 1106a)
A1V6M0 3.1e-13 63 32 1 92 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain SAVP1)
Q62M28 3.1e-13 63 32 1 92 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain ATCC 23344)
A2S4R7 3.1e-13 63 32 1 92 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain NCTC 10229)
A3MHP1 3.1e-13 63 32 1 92 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain NCTC 10247)
A6TAI1 3.21e-13 62 32 0 93 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_17325
Feature type CDS
Gene hupB
Product nucleoid-associated protein HU-beta
Location 16871 - 17155 (strand: 1)
Length 285 (nucleotides) / 94 (amino acids)

Contig

Accession ZDB_536
Length 56187 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2114
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00216 Bacterial DNA-binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0776 Replication, recombination and repair (L) L Bacterial nucleoid DNA-binding protein IHF-alpha

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03530 DNA-binding protein HU-beta - -

Protein Sequence

MIIVNKSQLVDKIAADANISKAAAGRALDAIIGSVTDSLKGGDDVALVGFGTFTVRERAARTGRNPQTGKEIKIAAAKVPVFRAGKGLKDAVNG

Flanking regions ( +/- flanking 50bp)

GGCTGTCAGGAACATACTTCGTAAATCCGGGCCGAAAATTCTGAAAGGGGATGATAATAGTGAATAAGTCACAATTGGTCGATAAAATTGCTGCAGACGCTAATATTTCTAAAGCTGCGGCTGGTCGCGCGTTAGATGCAATTATTGGTTCAGTAACCGATTCTCTGAAGGGCGGGGATGACGTGGCTCTGGTTGGTTTCGGTACTTTCACTGTTCGTGAGCGTGCAGCACGTACAGGCCGTAACCCGCAGACCGGAAAAGAGATCAAAATCGCCGCTGCGAAAGTCCCGGTTTTCCGTGCAGGTAAAGGTCTTAAAGACGCAGTAAACGGCTGAGTTTTTCCTCAGGCACCGGGATATTTATCTGTCCCGGGCACAAAAACCGT