Homologs in group_3792

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15630 FBDBKF_15630 100.0 Morganella morganii S1 - Transcriptional regulator

Distribution of the homologs in the orthogroup group_3792

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3792

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12552 0.00025 38 32 1 55 4 None Uncharacterized protein ORF88 Enterobacteria phage P4

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16380
Feature type CDS
Gene -
Product Transcriptional regulator
Location 23049 - 23249 (strand: 1)
Length 201 (nucleotides) / 66 (amino acids)
In genomic island -

Contig

Accession ZDB_533
Length 80662 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3792
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF12728 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)
KX DNA-binding transcriptional regulator AlpA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07733 prophage regulatory protein - -

Protein Sequence

MTGNNQPKQEERLLTYAEVCDVLQTSQATLRRYVRDGRFPPPIKPNPNGRTVRFRCSDITAWLSDL

Flanking regions ( +/- flanking 50bp)

CTTTTTCGGGATGATTGCTCCTGCAAGTTAGATAATAAACAGGAGTCATCATGACGGGTAATAATCAACCTAAACAAGAAGAACGGTTACTGACTTATGCTGAAGTGTGTGACGTTTTGCAAACCTCGCAGGCGACACTTCGTCGTTACGTGCGAGATGGACGTTTTCCTCCTCCAATAAAACCCAATCCAAATGGTCGTACTGTTCGCTTTCGGTGCAGCGACATCACTGCTTGGTTGAGTGATTTGTGATGGGAGTTAGTGATGCAATATAAGTTGCAGGATGATGGGCTCTATTGCTT