Homologs in group_3792

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
NLDBIP_16380 NLDBIP_16380 100.0 Morganella morganii S4 - Transcriptional regulator

Distribution of the homologs in the orthogroup group_3792

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3792

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12552 0.00025 38 32 1 55 4 None Uncharacterized protein ORF88 Enterobacteria phage P4

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_15630
Feature type CDS
Gene -
Product Transcriptional regulator
Location 58114 - 58314 (strand: -1)
Length 201 (nucleotides) / 66 (amino acids)
In genomic island -

Contig

Accession contig_21
Length 81362 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3792
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF12728 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)
KX DNA-binding transcriptional regulator AlpA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07733 prophage regulatory protein - -

Protein Sequence

MTGNNQPKQEERLLTYAEVCDVLQTSQATLRRYVRDGRFPPPIKPNPNGRTVRFRCSDITAWLSDL

Flanking regions ( +/- flanking 50bp)

CTTTTTCGGGATGATTGCTCCTGCAAGTTAGATAATAAACAGGAGTCATCATGACGGGTAATAATCAACCTAAACAAGAAGAACGGTTACTGACTTATGCTGAAGTGTGTGACGTTTTGCAAACCTCGCAGGCGACACTTCGTCGTTACGTGCGAGATGGACGTTTTCCTCCTCCAATAAAACCCAATCCAAATGGTCGTACTGTTCGCTTTCGGTGCAGCGACATCACTGCTTGGTTGAGTGATTTGTGATGGGAGTTAGTGATGCAATATAAGTTGCAGGATGATGGGCTCTATTGCTT