Homologs in group_2852

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10825 FBDBKF_10825 100.0 Morganella morganii S1 cbiO Cobalt import ATP-binding protein CbiO
EHELCC_19415 EHELCC_19415 99.3 Morganella morganii S2 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
LHKJJB_14355 LHKJJB_14355 100.0 Morganella morganii S3 cbiO Cobalt import ATP-binding protein CbiO
HKOGLL_12975 HKOGLL_12975 100.0 Morganella morganii S5 cbiO Cobalt import ATP-binding protein CbiO
F4V73_RS16925 F4V73_RS16925 88.2 Morganella psychrotolerans - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_2852

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2852

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45275 8.56e-46 150 56 0 130 3 HI_1618 Uncharacterized ABC transporter ATP-binding protein HI_1618 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q72D73 7.84e-33 119 49 0 124 3 DVU_1056 Putative ABC transporter ATP-binding protein DVU_1056 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8FZV2 3.5e-32 116 46 0 130 3 BR1368 Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 Brucella suis biovar 1 (strain 1330)
Q2YQP3 8.72e-32 115 46 0 130 3 BAB1_1388 Putative ABC transporter ATP-binding protein BAB1_1388 Brucella abortus (strain 2308)
Q57CD8 8.72e-32 115 46 0 130 3 BruAb1_1365 Putative ABC transporter ATP-binding protein BruAb1_1365 Brucella abortus biovar 1 (strain 9-941)
O27739 5e-29 110 40 1 132 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q55740 8.7e-29 108 43 0 126 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8R7Y5 1.27e-28 108 38 2 135 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8PYH5 9.67e-28 107 37 1 132 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TIW9 1.05e-27 106 40 1 133 3 MA_4021 Putative ABC transporter ATP-binding protein MA_4021 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q2FNX9 1.5e-27 105 36 1 133 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q50801 2.06e-27 105 38 1 132 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q2NHA1 3.36e-26 102 38 1 120 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q890D1 4.15e-26 101 41 1 131 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
O26236 5.99e-26 101 38 1 131 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O68106 7.17e-26 101 40 1 135 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q74DN5 7.2e-26 100 39 0 130 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8XHV3 1.43e-25 100 39 3 139 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain 13 / Type A)
Q0TMS8 1.43e-25 100 39 3 139 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8TIX0 2.51e-25 100 35 1 132 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A3CVD3 2.55e-25 100 37 1 130 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q58488 8.63e-25 98 35 1 132 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q65P76 1.85e-24 97 37 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q890R3 5.27e-24 96 34 2 136 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium tetani (strain Massachusetts / E88)
Q8G838 6.13e-24 99 35 1 136 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 1.12e-16 78 35 1 120 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q97EK9 6.64e-24 96 34 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6LX68 6.65e-24 96 34 1 132 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q97KZ3 8.76e-24 95 36 1 132 3 CA_C0773 Putative ABC transporter ATP-binding protein CA_C0773 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A0R8K9 9.89e-24 96 37 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q6HPM9 1.01e-23 95 37 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 1.01e-23 95 37 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q8U4L3 1.3e-23 95 34 1 129 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8PZN0 2.46e-23 97 35 1 132 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8RD07 3.1e-23 93 36 2 134 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q81J15 4.03e-23 94 37 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A0PXX8 6.71e-23 94 33 2 136 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium novyi (strain NT)
Q03I83 7.43e-23 93 41 1 114 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M244 7.43e-23 93 41 1 114 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ4 7.43e-23 93 41 1 114 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain CNRZ 1066)
Q63H61 9.14e-23 93 38 2 131 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q748K0 9.5e-23 93 37 1 129 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8TYV9 1.18e-22 92 39 1 134 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8TK65 1.22e-22 95 34 1 132 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8XNY7 2.16e-22 92 38 1 122 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
P70970 2.17e-22 92 37 2 135 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q73F66 2.8e-22 92 36 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6XYZ3 2.82e-22 92 37 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Spiroplasma kunkelii
Q0TUN8 3.43e-22 92 39 1 122 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q74L61 7.99e-22 90 37 2 122 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6G4Q8 8.14e-22 89 33 1 132 3 BH02760 Putative ABC transporter ATP-binding protein BH02760 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7N0N3 8.7e-22 89 34 0 121 3 plu3849 Putative ABC transporter ATP-binding protein plu3849 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8TTN2 9.18e-22 92 34 1 129 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8KFD6 1.23e-21 90 36 1 133 3 CT0391 Putative ABC transporter ATP-binding protein CT0391 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q045Z7 1.37e-21 90 38 2 122 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q0SWH9 1.53e-21 90 38 1 122 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q7NNW9 2.85e-21 88 44 1 128 3 gll0289 Putative ABC transporter ATP-binding protein gll0289 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q6G1D9 3.42e-21 88 32 1 132 3 BQ02700 Putative ABC transporter ATP-binding protein BQ02700 Bartonella quintana (strain Toulouse)
Q82HA2 3.67e-21 88 35 0 128 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q67JX4 3.74e-21 89 37 2 134 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q4A5A4 4.21e-21 89 37 2 134 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis synoviae (strain 53)
Q3ABN1 5.15e-21 88 35 1 133 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
O57872 5.18e-21 88 34 1 129 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O54187 6e-21 88 39 1 129 3 SCO5958 Putative ABC transporter ATP-binding protein SCO5958 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q18CI9 7.29e-21 88 34 2 136 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
Q9V2E4 1.27e-20 87 33 1 129 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q9CIS8 1.61e-20 87 38 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q2FRT7 1.97e-20 88 33 1 133 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8DRS0 2e-20 87 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9KGD6 2.02e-20 87 36 3 138 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9HPH7 2.51e-20 86 36 2 132 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q51719 2.88e-20 87 37 1 126 3 None Putative ABC transporter ATP-binding protein in cobA 5'region Propionibacterium freudenreichii subsp. shermanii
Q03I82 3.28e-20 86 36 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M243 3.32e-20 86 36 1 122 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 3.32e-20 86 36 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q8DG84 3.89e-20 86 34 1 133 3 tll2439 Putative ABC transporter ATP-binding protein tll2439 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A0ALT6 3.94e-20 86 33 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q927N9 4.2e-20 86 33 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9RKC6 4.28e-20 85 34 0 130 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8Y455 4.76e-20 86 33 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71WH8 4.76e-20 86 33 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q8ETV6 4.98e-20 86 35 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q032H3 1.42e-19 85 44 1 97 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI02 1.67e-19 84 44 1 97 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q8DWR4 2.18e-19 84 40 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 2.18e-19 84 40 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 2.18e-19 84 40 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5L3Q9 2.45e-19 84 32 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
Q8DMY0 2.49e-19 84 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 2.49e-19 84 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8PSR0 3.95e-19 85 35 1 130 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 6.77e-18 82 32 1 129 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q48QM2 5.91e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 5.91e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J982 5.91e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0C0E8 5.91e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
P0CZ27 5.92e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 5.92e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q6KHL2 6.29e-19 83 32 2 136 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P0C0E9 6.42e-19 83 34 1 122 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 6.42e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 6.42e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 6.42e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 6.42e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 6.42e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 6.42e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 6.42e-19 83 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A2RH10 6.71e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 6.71e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 6.71e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 6.71e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 6.71e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 6.71e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 6.71e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 6.71e-19 83 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q48QM3 7.22e-19 82 39 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q97N51 7.35e-19 82 38 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q2SRI2 9.2e-19 82 35 3 138 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q04FM1 1.06e-18 82 35 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q839D4 1.18e-18 82 36 3 125 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q50293 1.52e-18 82 40 2 105 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A3CRB8 1.57e-18 82 37 2 121 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q8TQ05 1.64e-18 83 32 1 129 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 6.77e-17 79 38 0 105 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8R9L8 1.73e-18 83 32 1 128 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R9L8 9.62e-12 64 31 2 126 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q73KT5 1.87e-18 81 34 1 132 3 TDE_2132 Putative ABC transporter ATP-binding protein TDE_2132 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q6MSQ2 2.39e-18 82 34 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P47426 2.62e-18 81 41 1 95 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q2LY16 2.81e-18 81 34 1 121 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
A3CRB9 3.55e-18 81 37 1 121 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q8DRR9 4.63e-18 80 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5FM62 5.7e-18 80 40 1 98 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q98QH4 5.84e-18 80 33 2 122 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8PY26 8.13e-18 80 35 2 122 3 MM_1038 Putative ABC transporter ATP-binding protein MM_1038 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O28437 8.79e-18 79 30 0 130 3 AF_1841 Putative ABC transporter ATP-binding protein AF_1841 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A3DJK5 1.05e-17 79 29 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8DMX9 1.11e-17 79 33 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 1.11e-17 79 33 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 1.11e-17 79 33 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q4L884 1.14e-17 79 33 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
Q1WSB9 1.24e-17 79 33 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
D5AQY6 1.36e-17 79 35 2 135 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q81J16 1.55e-17 79 36 3 125 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6F1W4 2.26e-17 79 32 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
O59479 2.27e-17 79 34 1 132 3 PH1815 Putative ABC transporter ATP-binding protein PH1815 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q03ZL5 2.6e-17 79 34 2 134 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q97JB8 2.85e-17 78 30 1 133 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9HMZ4 3.36e-17 77 34 1 132 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q4A5A5 4.45e-17 78 31 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q8U3E0 5.08e-17 77 31 1 124 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q2KBP5 5.14e-17 77 36 1 128 1 bioM Biotin transport ATP-binding protein BioM Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8DWR3 7.08e-17 77 35 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 7.08e-17 77 35 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 7.08e-17 77 35 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q9V1Q4 7.62e-17 77 33 1 132 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q97WT4 9.59e-17 78 32 2 131 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97WT4 9.57e-05 44 33 3 109 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q6HPN0 1.13e-16 77 40 2 111 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 1.13e-16 77 40 2 111 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 1.13e-16 77 40 2 111 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
A0PXX7 1.15e-16 77 33 1 121 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium novyi (strain NT)
Q63H62 1.15e-16 77 40 2 111 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q03PY6 1.17e-16 77 36 3 137 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q58967 1.18e-16 77 39 1 97 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8PUE7 1.4e-16 78 34 1 128 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 1.9e-11 63 29 1 128 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8ETV7 1.46e-16 76 37 4 137 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q73F67 1.52e-16 76 40 2 111 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q73R11 1.69e-16 77 31 1 129 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73R11 1.16e-06 49 28 2 119 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q88XV1 1.7e-16 76 36 3 138 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6GEL3 2.33e-16 76 32 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q67JX3 2.87e-16 76 40 0 94 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q839D5 3.57e-16 75 34 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q38UU0 3.74e-16 75 42 1 95 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q0SQH5 4.39e-16 75 34 2 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain SM101 / Type A)
Q8XHV2 4.48e-16 75 34 2 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain 13 / Type A)
Q0TMS7 4.48e-16 75 34 2 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q03EE4 4.86e-16 75 33 1 122 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q04EY5 6.08e-16 75 31 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q4A8A1 8.36e-16 75 31 3 136 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 7448)
Q4AA74 8.45e-16 75 30 2 136 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q601T6 8.45e-16 75 30 2 136 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 232)
Q8R7Y4 8.45e-16 74 39 0 94 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q035B2 8.55e-16 74 32 2 133 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q73P93 8.72e-16 75 30 1 126 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 1.21e-06 49 27 3 128 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q7A470 1.01e-15 74 31 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 1.01e-15 74 31 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YYM4 1.04e-15 74 31 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
O29527 1.14e-15 74 28 1 129 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q97X60 1.42e-15 75 31 2 131 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q5HDY6 1.54e-15 73 31 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 1.54e-15 73 31 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 1.54e-15 73 31 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q8NVB5 1.85e-15 73 31 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 1.85e-15 73 31 1 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
A3DJK3 2.09e-15 73 32 1 121 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q890R2 2.11e-15 73 32 1 121 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium tetani (strain Massachusetts / E88)
Q8VNL9 2.46e-15 73 33 1 122 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
Q38UT9 2.93e-15 73 37 1 107 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q04BY6 3.24e-15 73 43 2 98 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBI9 3.24e-15 73 43 2 98 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q9PPV2 3.59e-15 73 32 2 134 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q8TI15 4.5e-15 72 35 2 118 3 MA_4342 Putative ABC transporter ATP-binding protein MA_4342 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q03PY5 5.09e-15 72 33 1 122 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q0AUL1 5.41e-15 72 42 0 88 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q97EK8 6.99e-15 72 37 1 110 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P0A2V9 7.28e-15 72 31 5 140 1 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2V8 7.28e-15 72 31 5 140 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9CIS9 7.29e-15 72 31 2 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q032H4 8.67e-15 72 36 0 94 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 8.67e-15 72 36 0 94 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
P54537 1.06e-14 71 29 4 135 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q9RRL9 1.09e-14 70 32 0 118 3 DR_2469 Putative ABC transporter ATP-binding protein DR_2469 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q5HM28 1.12e-14 71 29 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CRI7 1.17e-14 71 29 2 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q92CK1 1.37e-14 71 31 1 121 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8RHL0 1.55e-14 71 31 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2NIT5 2.27e-14 70 27 1 133 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q7A088 2.6e-14 70 32 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 2.6e-14 70 32 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 2.6e-14 70 32 3 135 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 2.6e-14 70 32 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 2.6e-14 70 32 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 2.6e-14 70 32 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 2.6e-14 70 32 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
Q2YYM5 2.65e-14 70 32 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GEL4 2.79e-14 70 32 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q8Y454 3.11e-14 70 33 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8YQ88 3.63e-14 70 31 1 121 3 alr3946 Putative ABC transporter ATP-binding protein alr3946 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q927N8 3.73e-14 70 33 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q71WH7 4.01e-14 70 33 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q035B3 4.01e-14 70 35 1 109 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q6YR39 4.84e-14 69 29 1 125 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q65P77 5.77e-14 69 37 0 94 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q7NAQ7 7.35e-14 69 31 3 135 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q1WSB8 7.44e-14 69 29 2 134 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q8PVG9 8.59e-14 70 29 2 134 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 9.94e-14 70 30 1 128 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q49ZD9 9.23e-14 69 31 2 122 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O34362 1e-13 70 32 1 117 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 1.73e-06 49 24 2 133 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q8TSC8 1.03e-13 70 26 1 134 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 3.61e-12 65 29 1 128 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 1.1e-13 69 31 1 128 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 3.26e-09 57 27 1 129 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q18CJ0 1.17e-13 68 36 2 108 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q8ELT4 1.2e-13 68 30 5 140 3 pstB Phosphate import ATP-binding protein PstB Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4L885 1.2e-13 68 31 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q88XV2 1.3e-13 68 35 0 101 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8G195 1.36e-13 68 36 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella suis biovar 1 (strain 1330)
Q8YGM0 1.36e-13 68 36 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57DS9 1.36e-13 68 36 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella abortus biovar 1 (strain 9-941)
Q2YNH6 1.36e-13 68 36 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella abortus (strain 2308)
A0ALT7 1.39e-13 68 32 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q04EY4 1.47e-13 68 32 2 121 3 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
P40735 1.6e-13 68 36 0 94 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q8Y7R4 1.63e-13 68 30 1 121 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8RQL7 1.74e-13 68 30 4 135 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q720M2 2e-13 68 30 1 121 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q6HG98 2.59e-13 68 30 1 130 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81N53 2.86e-13 68 30 1 130 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q03ZL6 3.03e-13 67 36 0 90 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q5HVF4 3.05e-13 67 31 5 141 3 pstB Phosphate import ATP-binding protein PstB Campylobacter jejuni (strain RM1221)
Q9PHQ1 3.09e-13 67 31 5 141 3 pstB Phosphate import ATP-binding protein PstB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q734T1 3.75e-13 68 30 1 130 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
P63372 3.77e-13 67 29 4 139 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63371 3.77e-13 67 29 4 139 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype III (strain NEM316)
Q972J5 4e-13 68 29 1 128 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q972J5 0.000111 43 35 0 74 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q3JYY5 4.08e-13 67 29 4 139 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q897I2 4.51e-13 68 29 2 129 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 5.74e-08 53 27 2 111 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
P27675 4.59e-13 67 30 4 135 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q46BM0 4.78e-13 67 32 5 133 3 pstB Phosphate import ATP-binding protein PstB Methanosarcina barkeri (strain Fusaro / DSM 804)
Q12XW6 5.51e-13 67 28 4 139 3 pstB Phosphate import ATP-binding protein PstB Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q9WY65 5.61e-13 67 31 3 135 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8EUF1 6.06e-13 67 31 2 138 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Malacoplasma penetrans (strain HF-2)
Q6ME20 6.42e-13 67 31 3 134 3 metN Methionine import ATP-binding protein MetN Protochlamydia amoebophila (strain UWE25)
Q5HPF5 6.84e-13 67 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CPA1 7.49e-13 67 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q4L691 8.28e-13 66 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus haemolyticus (strain JCSC1435)
Q04BY7 8.3e-13 66 30 1 122 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
P63363 8.55e-13 66 29 4 139 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71WT3 8.55e-13 66 29 4 139 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria monocytogenes serotype 4b (strain F2365)
P63364 8.55e-13 66 29 4 139 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q74L62 8.82e-13 66 35 0 94 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q1GBJ0 9e-13 66 30 1 122 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q5FM63 9.07e-13 66 33 3 125 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q3B3H7 1.01e-12 66 28 4 139 3 pstB Phosphate import ATP-binding protein PstB Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q0SVB6 1.14e-12 65 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain SM101 / Type A)
Q8XMP8 1.14e-12 65 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain 13 / Type A)
Q0TTG6 1.14e-12 65 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q50294 1.14e-12 66 30 0 108 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O28912 1.21e-12 65 31 6 141 3 pstB Phosphate import ATP-binding protein PstB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9K8L5 1.24e-12 66 30 5 140 3 pstB Phosphate import ATP-binding protein PstB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q58418 1.33e-12 65 30 5 140 3 pstB Phosphate import ATP-binding protein PstB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6XYT0 1.41e-12 65 30 5 134 3 pstB Phosphate import ATP-binding protein PstB Spiroplasma kunkelii
Q82B58 1.54e-12 66 29 1 134 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q82B58 4.13e-06 48 30 3 130 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8KDZ5 1.57e-12 65 28 5 140 3 pstB Phosphate import ATP-binding protein PstB Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P02915 1.73e-12 65 33 5 136 1 hisP Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55662 2.02e-12 65 30 4 138 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7MFH3 2.15e-12 66 25 2 136 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 9.75e-06 47 27 0 104 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q18C09 2.2e-12 65 32 2 133 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q5V225 2.2e-12 65 27 4 137 3 pstB1 Phosphate import ATP-binding protein PstB 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P07109 2.26e-12 65 33 5 136 1 hisP Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP Escherichia coli (strain K12)
Q8RHK9 2.31e-12 65 30 2 131 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9PQU3 2.37e-12 65 28 4 139 3 pstB Phosphate import ATP-binding protein PstB Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q8D3Z9 2.39e-12 66 25 2 136 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 2.63e-06 48 27 0 104 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
O34677 2.45e-12 65 31 4 135 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q6G3A6 3e-12 64 33 1 112 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q2YXY2 3.07e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain bovine RF122 / ET3-1)
P40860 3.09e-12 65 34 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6GH21 3.17e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MRSA252)
P69880 3.3e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MW2)
Q6G9H4 3.3e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MSSA476)
P69879 3.3e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain N315)
P69878 3.3e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P69881 3.3e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain COL)
Q2FYQ0 3.3e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH51 3.3e-12 65 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain USA300)
Q180A5 3.36e-12 64 30 5 140 3 pstB Phosphate import ATP-binding protein PstB Clostridioides difficile (strain 630)
Q8CRI6 3.55e-12 64 33 0 110 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM27 3.55e-12 64 33 0 110 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8Z4V6 3.75e-12 65 34 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q818I7 3.87e-12 64 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P48243 4.04e-12 64 28 4 135 1 gluA Glutamate transport ATP-binding protein GluA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q2LVM2 4.06e-12 63 37 3 115 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Syntrophus aciditrophicus (strain SB)
Q6HDP8 4.24e-12 64 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634R8 4.24e-12 64 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ZK / E33L)
Q730R7 4.24e-12 64 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81LW6 4.24e-12 64 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Bacillus anthracis
Q5FM18 4.37e-12 64 29 4 139 3 pstB1 Phosphate import ATP-binding protein PstB 1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q11JI6 4.51e-12 63 34 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Chelativorans sp. (strain BNC1)
Q2JTU3 4.55e-12 64 31 5 132 3 pstB2 Phosphate import ATP-binding protein PstB 2 Synechococcus sp. (strain JA-3-3Ab)
Q49XI8 4.62e-12 64 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8PVF6 4.64e-12 64 30 5 133 3 pstB Phosphate import ATP-binding protein PstB Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q3AAA4 5.21e-12 64 30 5 141 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q88YK8 5.32e-12 64 28 4 139 3 pstB1 Phosphate import ATP-binding protein PstB 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8PY27 5.53e-12 64 30 2 122 3 MM_1037 Putative ABC transporter ATP-binding protein MM_1037 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9X0Y8 5.78e-12 63 32 4 125 3 pstB Phosphate import ATP-binding protein PstB Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0AAG3 5.78e-12 63 29 4 135 3 gltL Glutamate/aspartate import ATP-binding protein GltL Escherichia coli (strain K12)
P0AAG4 5.78e-12 63 29 4 135 3 gltL Glutamate/aspartate import ATP-binding protein GltL Escherichia coli O157:H7
Q74KF9 5.98e-12 64 30 4 139 3 pstB1 Phosphate import ATP-binding protein PstB 1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q2K9R2 6.12e-12 63 33 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q608V9 7.38e-12 64 36 5 133 3 modC Molybdenum import ATP-binding protein ModC Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6LSC4 8.4e-12 63 29 5 140 3 pstB2 Phosphate import ATP-binding protein PstB 2 Photobacterium profundum (strain SS9)
Q2JUA1 9.23e-12 63 32 4 131 3 pstB1 Phosphate import ATP-binding protein PstB 1 Synechococcus sp. (strain JA-3-3Ab)
Q1MIJ4 9.43e-12 63 33 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P75356 1.13e-11 63 31 2 133 3 MPN_432 Putative ABC transporter ATP-binding protein MG303 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q6D201 1.19e-11 63 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q98KS7 1.26e-11 62 33 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5HAV5 1.29e-11 63 26 5 141 3 pstB Phosphate import ATP-binding protein PstB Ehrlichia ruminantium (strain Welgevonden)
Q5FFT1 1.29e-11 63 26 5 141 3 pstB Phosphate import ATP-binding protein PstB Ehrlichia ruminantium (strain Gardel)
Q084V3 1.31e-11 63 31 5 134 3 pstB Phosphate import ATP-binding protein PstB Shewanella frigidimarina (strain NCIMB 400)
Q9Z9J3 1.36e-11 63 33 0 108 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8UFV7 1.37e-11 62 33 1 113 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Agrobacterium fabrum (strain C58 / ATCC 33970)
Q52666 1.41e-11 63 30 4 135 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q2LTG0 1.42e-11 63 29 4 133 3 pstB Phosphate import ATP-binding protein PstB Syntrophus aciditrophicus (strain SB)
Q3IS07 1.43e-11 63 29 4 137 3 pstB1 Phosphate import ATP-binding protein PstB 1 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
P47545 1.44e-11 63 29 3 134 3 MG303 Putative ABC transporter ATP-binding protein MG303 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q5FKL2 1.72e-11 63 29 2 132 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q3ZWN4 1.82e-11 62 29 4 133 3 pstB Phosphate import ATP-binding protein PstB Dehalococcoides mccartyi (strain CBDB1)
Q8R9I2 1.87e-11 62 29 5 135 3 pstB2 Phosphate import ATP-binding protein PstB 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q49W48 1.96e-11 63 29 4 133 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q0D9V6 2.07e-11 63 35 3 130 1 STAR1 Protein STAR1 Oryza sativa subsp. japonica
Q83CV2 2.09e-11 62 32 1 97 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q12L15 2.19e-11 62 32 5 134 3 pstB Phosphate import ATP-binding protein PstB Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q2RM86 2.28e-11 62 29 5 134 3 pstB Phosphate import ATP-binding protein PstB Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q7N6Z2 2.37e-11 63 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q5KX47 2.37e-11 62 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Geobacillus kaustophilus (strain HTA426)
Q2RFS8 2.52e-11 62 39 2 108 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8FFB3 2.56e-11 62 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7UC29 2.71e-11 62 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
P16676 2.82e-11 62 32 4 135 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8XBJ8 2.82e-11 62 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q8DU24 2.88e-11 62 32 5 137 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q0HTE5 2.99e-11 62 31 5 134 3 pstB Phosphate import ATP-binding protein PstB Shewanella sp. (strain MR-7)
Q0HH38 2.99e-11 62 31 5 134 3 pstB Phosphate import ATP-binding protein PstB Shewanella sp. (strain MR-4)
Q8EG82 2.99e-11 62 31 5 134 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6G2E2 3.02e-11 62 29 4 134 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6G4T6 3.06e-11 62 27 5 142 3 pstB Phosphate import ATP-binding protein PstB Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q8A853 3.12e-11 62 29 6 140 3 pstB Phosphate import ATP-binding protein PstB Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q1GUY1 3.34e-11 62 28 5 142 3 pstB Phosphate import ATP-binding protein PstB Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q92XW1 3.46e-11 62 34 5 135 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q8TI16 3.46e-11 62 34 0 94 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q49ZE0 3.55e-11 62 38 2 97 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q3ZA58 3.99e-11 61 28 4 133 3 pstB Phosphate import ATP-binding protein PstB Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q72GX5 4.06e-11 62 28 4 137 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5SLN1 4.14e-11 62 28 4 137 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q04DA7 4.15e-11 62 28 3 135 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q2JMJ0 4.17e-11 62 33 5 133 3 pstB1 Phosphate import ATP-binding protein PstB 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q8TUR7 4.39e-11 61 34 5 123 3 pstB Phosphate import ATP-binding protein PstB Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q97IE0 4.51e-11 61 30 5 140 3 pstB Phosphate import ATP-binding protein PstB Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q3ATA4 4.53e-11 61 29 5 141 3 pstB Phosphate import ATP-binding protein PstB Chlorobium chlorochromatii (strain CaD3)
P45092 4.54e-11 61 27 4 136 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q88YK7 4.79e-11 61 31 5 140 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q87G59 5e-11 61 29 5 140 3 pstB2 Phosphate import ATP-binding protein PstB 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q03ZQ0 5.04e-11 62 31 2 114 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q9PPV1 5.12e-11 61 32 3 116 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q6XYZ4 5.21e-11 61 31 0 108 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Spiroplasma kunkelii
Q5LS19 5.53e-11 61 27 4 140 3 pstB Phosphate import ATP-binding protein PstB Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
O30506 6.14e-11 61 28 4 135 3 aotP Arginine/ornithine transport ATP-binding protein AotP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O67154 6.23e-11 61 29 5 134 3 pstB Phosphate import ATP-binding protein PstB Aquifex aeolicus (strain VF5)
Q0SNU4 6.44e-11 61 28 5 140 3 pstB Phosphate import ATP-binding protein PstB Borreliella afzelii (strain PKo)
Q1GAD3 6.54e-11 61 30 5 138 3 pstB Phosphate import ATP-binding protein PstB Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q8H1R4 6.64e-11 61 33 3 121 1 ABCI10 ABC transporter I family member 10 Arabidopsis thaliana
Q8YNJ3 7.19e-11 61 27 4 140 3 pstB3 Phosphate import ATP-binding protein PstB 3 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8DQH4 7.27e-11 60 29 5 139 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 7.27e-11 60 29 5 139 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P63362 7.67e-11 61 27 5 140 3 pstB Phosphate import ATP-binding protein PstB Brucella suis biovar 1 (strain 1330)
P63361 7.67e-11 61 27 5 140 3 pstB Phosphate import ATP-binding protein PstB Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57AC2 7.67e-11 61 27 5 140 3 pstB Phosphate import ATP-binding protein PstB Brucella abortus biovar 1 (strain 9-941)
Q2YQT8 7.67e-11 61 27 5 140 3 pstB Phosphate import ATP-binding protein PstB Brucella abortus (strain 2308)
Q0SML1 7.72e-11 61 33 3 115 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q6G0L7 8.26e-11 60 27 5 142 3 pstB Phosphate import ATP-binding protein PstB Bartonella quintana (strain Toulouse)
Q1WVI7 8.36e-11 61 30 3 126 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q88CL2 8.44e-11 61 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9C9W0 8.48e-11 60 32 4 131 2 ABCI17 ABC transporter I family member 17 Arabidopsis thaliana
Q5WET8 8.81e-11 60 28 5 140 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shouchella clausii (strain KSM-K16)
Q9HML8 9.25e-11 61 29 6 152 3 pstB2 Phosphate import ATP-binding protein PstB 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q2W7J9 9.76e-11 60 26 5 141 3 pstB2 Phosphate import ATP-binding protein PstB 2 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
O27764 9.79e-11 60 28 5 139 3 pstB Phosphate import ATP-binding protein PstB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q6AM16 9.82e-11 60 27 5 142 3 pstB Phosphate import ATP-binding protein PstB Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q660M8 1.05e-10 61 33 3 115 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q6KHL1 1.06e-10 60 31 0 96 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q0I2Z4 1.07e-10 61 30 2 113 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
Q71WT2 1.09e-10 60 28 4 133 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serotype 4b (strain F2365)
Q93DX8 1.1e-10 60 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q04F14 1.1e-10 61 26 2 133 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q9KXJ6 1.11e-10 61 27 1 134 3 SCO2324 Putative ABC transporter ATP-binding protein SCO2324 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KXJ6 8.25e-06 47 37 1 72 3 SCO2324 Putative ABC transporter ATP-binding protein SCO2324 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P35116 1.12e-10 60 31 4 135 3 nocP Nopaline permease ATP-binding protein P Agrobacterium fabrum (strain C58 / ATCC 33970)
Q927Z7 1.12e-10 60 28 4 133 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8D0W8 1.12e-10 61 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
Q15QL7 1.12e-10 60 28 5 142 3 pstB Phosphate import ATP-binding protein PstB Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1QVQ7 1.13e-10 61 34 6 136 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8Y4E9 1.13e-10 60 28 4 133 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q668K6 1.13e-10 61 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8D3X4 1.14e-10 60 28 5 140 3 pstB2 Phosphate import ATP-binding protein PstB 2 Vibrio vulnificus (strain CMCP6)
O51587 1.18e-10 60 33 3 115 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P14788 1.18e-10 60 31 3 131 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P63374 1.2e-10 60 31 5 137 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P63373 1.2e-10 60 31 5 137 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6LY93 1.2e-10 60 28 5 134 3 pstB Phosphate import ATP-binding protein PstB Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q7MFE8 1.24e-10 60 28 5 140 3 pstB2 Phosphate import ATP-binding protein PstB 2 Vibrio vulnificus (strain YJ016)
Q7NAQ6 1.41e-10 60 34 3 111 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q2S081 1.43e-10 60 29 4 131 3 pstB Phosphate import ATP-binding protein PstB Salinibacter ruber (strain DSM 13855 / M31)
Q5L3R0 1.44e-10 60 30 0 109 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
Q8NQU4 1.49e-10 60 27 4 134 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P10346 1.49e-10 60 29 2 113 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q6FZX3 1.52e-10 59 31 1 112 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bartonella quintana (strain Toulouse)
Q662E6 1.56e-10 60 27 5 140 3 pstB Phosphate import ATP-binding protein PstB Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q045Z8 1.56e-10 60 32 0 94 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q38YC1 1.58e-10 60 28 4 139 3 pstB2 Phosphate import ATP-binding protein PstB 2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q2G607 1.6e-10 60 27 5 141 3 pstB Phosphate import ATP-binding protein PstB Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q67RE7 1.6e-10 60 31 5 132 3 pstB2 Phosphate import ATP-binding protein PstB 2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q92VJ2 1.65e-10 60 34 5 135 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q0C0L5 1.66e-10 60 26 4 140 3 pstB Phosphate import ATP-binding protein PstB Hyphomonas neptunium (strain ATCC 15444)
Q895Y0 1.68e-10 60 27 4 133 3 pstB Phosphate import ATP-binding protein PstB Clostridium tetani (strain Massachusetts / E88)
Q92SA1 1.74e-10 60 27 5 142 3 pstB Phosphate import ATP-binding protein PstB Rhizobium meliloti (strain 1021)
Q834B4 1.82e-10 60 28 4 139 3 pstB1 Phosphate import ATP-binding protein PstB 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q87G35 1.86e-10 60 24 1 130 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 3.29e-07 51 25 2 131 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5P4W2 1.88e-10 60 33 4 136 3 modC Molybdenum import ATP-binding protein ModC Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6F1W5 1.88e-10 60 29 0 107 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q46Y69 2.08e-10 60 31 4 133 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3J376 2.1e-10 59 28 5 142 3 pstB Phosphate import ATP-binding protein PstB Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q1QXH6 2.16e-10 59 29 4 134 3 pstB1 Phosphate import ATP-binding protein PstB 1 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3IM36 2.24e-10 59 29 4 136 3 pstB3 Phosphate import ATP-binding protein PstB 3 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q5NNN6 2.25e-10 60 32 6 134 3 pstB Phosphate import ATP-binding protein PstB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q21E72 2.26e-10 60 26 5 142 3 pstB Phosphate import ATP-binding protein PstB Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8EUJ1 2.34e-10 60 29 5 140 3 pstB Phosphate import ATP-binding protein PstB Malacoplasma penetrans (strain HF-2)
Q8XK20 2.45e-10 60 23 1 129 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 9.74e-08 52 27 1 117 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q28Q03 2.52e-10 59 26 4 140 3 pstB Phosphate import ATP-binding protein PstB Jannaschia sp. (strain CCS1)
Q110U3 2.53e-10 60 31 4 133 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
O86751 2.55e-10 60 31 3 131 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q52815 2.55e-10 59 28 4 135 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6KIS8 2.92e-10 59 27 5 140 3 pstB Phosphate import ATP-binding protein PstB Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q89UD2 3.01e-10 59 31 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3KJQ7 3.06e-10 59 34 2 104 3 tauB Taurine import ATP-binding protein TauB Pseudomonas fluorescens (strain Pf0-1)
P45022 3.06e-10 59 33 2 115 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q88ZZ2 3.18e-10 60 34 1 117 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 7.43e-08 53 21 1 130 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P45769 3.26e-10 59 30 4 135 3 yhdZ Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ Escherichia coli (strain K12)
Q6KIP2 3.27e-10 60 36 2 90 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q9I6L0 3.33e-10 59 31 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q64SM5 3.46e-10 59 28 6 140 3 pstB Phosphate import ATP-binding protein PstB Bacteroides fragilis (strain YCH46)
Q5LBQ4 3.46e-10 59 28 6 140 3 pstB Phosphate import ATP-binding protein PstB Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q87S48 3.53e-10 59 30 5 134 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6FCW7 3.55e-10 59 26 4 140 3 pstB Phosphate import ATP-binding protein PstB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P46342 3.9e-10 58 27 6 142 3 pstB1 Phosphate import ATP-binding protein PstB 1 Bacillus subtilis (strain 168)
Q2KCV5 3.95e-10 59 26 5 142 3 pstB Phosphate import ATP-binding protein PstB Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q88AS5 4.02e-10 59 32 4 135 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1WVG9 4.03e-10 59 28 4 135 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q2SNX4 4.2e-10 59 29 5 134 3 pstB Phosphate import ATP-binding protein PstB Hahella chejuensis (strain KCTC 2396)
Q5HC57 4.25e-10 58 29 5 131 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ehrlichia ruminantium (strain Welgevonden)
Q5FFC0 4.25e-10 58 29 5 131 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ehrlichia ruminantium (strain Gardel)
Q5E3B8 4.26e-10 58 29 5 134 3 pstB2 Phosphate import ATP-binding protein PstB 2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6AMR9 4.29e-10 58 33 1 109 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q1GH74 4.33e-10 58 26 4 140 3 pstB Phosphate import ATP-binding protein PstB Ruegeria sp. (strain TM1040)
Q8UI76 4.37e-10 58 26 5 142 3 pstB Phosphate import ATP-binding protein PstB Agrobacterium fabrum (strain C58 / ATCC 33970)
O06476 4.44e-10 59 37 1 99 3 yfmR Uncharacterized ABC transporter ATP-binding protein YfmR Bacillus subtilis (strain 168)
O06476 3.23e-08 54 36 0 72 3 yfmR Uncharacterized ABC transporter ATP-binding protein YfmR Bacillus subtilis (strain 168)
Q9KN92 4.51e-10 58 28 5 140 3 pstB2 Phosphate import ATP-binding protein PstB 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O51236 4.72e-10 58 28 6 142 3 pstB Phosphate import ATP-binding protein PstB Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q04G50 4.86e-10 59 31 2 114 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q1J0N0 5.08e-10 58 33 6 135 3 pstB Phosphate import ATP-binding protein PstB Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q7M9G3 5.14e-10 58 26 4 140 3 pstB Phosphate import ATP-binding protein PstB Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7AH43 5.14e-10 59 30 2 102 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q97ZT9 5.27e-10 58 27 6 140 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q67RG2 5.29e-10 58 27 4 133 3 pstB1 Phosphate import ATP-binding protein PstB 1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q9HZS1 5.41e-10 58 30 5 136 3 hisP Histidine transport ATP-binding protein HisP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6GIH9 5.43e-10 58 29 4 133 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MRSA252)
Q2NHW1 5.56e-10 58 26 5 140 3 pstB Phosphate import ATP-binding protein PstB Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
P47425 5.76e-10 58 28 2 112 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_14990
Feature type CDS
Gene cbiO
Product Cobalt import ATP-binding protein CbiO
Location 133643 - 134053 (strand: -1)
Length 411 (nucleotides) / 136 (amino acids)

Contig

Accession ZDB_530
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2852
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1122 Inorganic ion transport and metabolism (P)
General function prediction only (R)
PR Energy-coupling factor transporter ATP-binding protein EcfA2

Protein Sequence

MRGPLGLLFQHPDDQLFGPGVLDDVMFGPLNMGMTQDAARERALQCLEMLDIVRLKDRAVTEISGGEKNFTALAGVLAMSPSVLLLDEPTNGLNEKNIQRLEDILTQLDLPMIVASHNQQFTQRMAHRVIPFPCRS

Flanking regions ( +/- flanking 50bp)

ATATTTCGGTTTTCGGCAAATCCCGTCTTTCGGAAGATGATTTCACAGAGGTGCGCGGCCCGCTGGGATTGCTGTTTCAGCATCCGGATGATCAGCTGTTCGGCCCGGGTGTGCTGGATGATGTGATGTTTGGTCCGCTGAATATGGGGATGACACAGGATGCGGCGCGGGAACGCGCTTTACAGTGCCTGGAAATGCTGGATATTGTCCGGCTGAAAGACCGCGCTGTGACTGAGATTTCCGGCGGAGAGAAAAACTTCACCGCACTGGCCGGTGTGCTGGCAATGTCGCCGTCTGTTCTGTTGCTGGATGAGCCGACCAACGGACTCAATGAGAAAAATATTCAGCGTCTGGAAGACATTCTTACACAACTGGATCTGCCGATGATTGTGGCCTCGCATAATCAGCAGTTTACACAGCGGATGGCGCACCGCGTGATCCCGTTCCCCTGCCGCTCCTGAGCCTGATATAAAAAACCCCCGGCAGCGGTTGTCCGGCTGCCGGGGGTCTG