Homologs in group_2873

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10825 FBDBKF_10825 88.2 Morganella morganii S1 cbiO Cobalt import ATP-binding protein CbiO
EHELCC_19415 EHELCC_19415 86.0 Morganella morganii S2 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
NLDBIP_14990 NLDBIP_14990 88.2 Morganella morganii S4 cbiO Cobalt import ATP-binding protein CbiO
LHKJJB_14355 LHKJJB_14355 88.2 Morganella morganii S3 cbiO Cobalt import ATP-binding protein CbiO
HKOGLL_12975 HKOGLL_12975 88.2 Morganella morganii S5 cbiO Cobalt import ATP-binding protein CbiO

Distribution of the homologs in the orthogroup group_2873

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2873

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45275 1.98e-69 214 52 1 208 3 HI_1618 Uncharacterized ABC transporter ATP-binding protein HI_1618 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FZV2 3.39e-53 173 46 0 203 3 BR1368 Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 Brucella suis biovar 1 (strain 1330)
Q2YQP3 6.72e-53 172 46 0 203 3 BAB1_1388 Putative ABC transporter ATP-binding protein BAB1_1388 Brucella abortus (strain 2308)
Q57CD8 6.72e-53 172 46 0 203 3 BruAb1_1365 Putative ABC transporter ATP-binding protein BruAb1_1365 Brucella abortus biovar 1 (strain 9-941)
Q72D73 4.44e-44 151 44 1 183 3 DVU_1056 Putative ABC transporter ATP-binding protein DVU_1056 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O27739 2.99e-39 140 38 3 195 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8TIW9 3.59e-39 139 40 4 199 3 MA_4021 Putative ABC transporter ATP-binding protein MA_4021 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PYH5 1.66e-37 135 35 4 210 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q74DN5 3.61e-37 132 36 3 204 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8TIX0 8.25e-37 134 36 5 209 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8RD07 1.94e-35 128 38 4 196 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R7Y5 3.14e-35 129 37 5 197 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q50801 3.44e-35 128 37 3 190 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q58488 5.51e-35 128 33 4 207 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q2NHA1 5.74e-35 128 34 4 198 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
O68106 6.83e-35 127 39 3 193 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8G838 9.72e-35 133 33 4 227 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 1.92e-27 112 36 2 176 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q55740 1.15e-34 127 36 3 209 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q890D1 2.5e-34 125 37 3 197 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
O26236 2.22e-33 124 36 3 190 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q890R3 1.02e-32 122 36 4 194 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium tetani (strain Massachusetts / E88)
Q97KZ3 1.34e-32 120 37 5 205 3 CA_C0773 Putative ABC transporter ATP-binding protein CA_C0773 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8TYV9 2.09e-32 121 39 3 188 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q18CI9 2.86e-32 121 36 5 212 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
A3CVD3 7.88e-32 119 33 4 207 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q2FRT7 1.24e-31 121 33 4 209 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
P70970 2.07e-31 118 35 4 195 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q03I82 2.23e-31 118 33 5 210 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q97EK9 2.49e-31 118 34 4 193 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5M243 2.7e-31 118 33 5 210 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 2.7e-31 118 33 5 210 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q2FNX9 3.1e-31 118 33 3 190 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
A0PXX7 3.71e-31 118 34 3 199 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium novyi (strain NT)
Q8XHV3 3.88e-31 118 35 5 198 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain 13 / Type A)
Q0TMS8 3.88e-31 118 35 5 198 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q74L61 5.56e-31 117 37 4 180 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8ETV6 7.09e-31 117 36 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q03PY5 9.14e-31 117 37 3 184 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A0PXX8 9.84e-31 117 34 4 194 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium novyi (strain NT)
Q8XNY7 1.27e-30 117 36 5 197 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q0TUN8 1.76e-30 116 36 5 197 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q03I83 1.8e-30 116 37 3 172 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M244 1.8e-30 116 37 3 172 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ4 1.8e-30 116 37 3 172 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain CNRZ 1066)
Q65P76 3.85e-30 115 35 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8PZN0 4.08e-30 118 38 5 183 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8DMX9 4.15e-30 115 33 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 4.15e-30 115 33 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 4.15e-30 115 33 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8DG84 4.2e-30 115 34 3 193 3 tll2439 Putative ABC transporter ATP-binding protein tll2439 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8KFD6 7.4e-30 115 36 3 188 3 CT0391 Putative ABC transporter ATP-binding protein CT0391 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q0SWH9 7.82e-30 114 36 5 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q6XYZ3 9.06e-30 115 34 4 196 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Spiroplasma kunkelii
Q8TTN2 1.22e-29 117 35 3 190 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q045Z7 1.54e-29 114 35 4 182 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8DRR9 1.91e-29 113 31 2 198 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8U4L3 2.09e-29 113 31 5 207 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q839D5 2.21e-29 113 34 4 199 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q6LX68 2.43e-29 113 32 3 192 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q97EK8 2.45e-29 113 34 3 197 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
O54187 2.53e-29 113 35 4 205 3 SCO5958 Putative ABC transporter ATP-binding protein SCO5958 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q97JB8 2.73e-29 113 32 2 190 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q51719 2.74e-29 113 36 5 201 3 None Putative ABC transporter ATP-binding protein in cobA 5'region Propionibacterium freudenreichii subsp. shermanii
Q81J16 3.41e-29 113 38 1 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8RHL0 5.32e-29 112 33 2 195 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q890R2 7.92e-29 112 33 2 190 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium tetani (strain Massachusetts / E88)
Q73F67 8.91e-29 112 38 1 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q50293 1.59e-28 111 37 4 167 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9V1Q4 2.35e-28 110 34 4 216 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q6HPN0 2.4e-28 110 38 1 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 2.4e-28 110 38 1 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 2.4e-28 110 38 1 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q035B2 2.54e-28 110 37 4 190 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q63H62 2.64e-28 110 38 1 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q81J15 2.65e-28 110 33 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P0CZ27 3.03e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 3.03e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48QM3 3.23e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RH10 3.47e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 3.47e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 3.47e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 3.47e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 3.47e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 3.47e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 3.47e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 3.47e-28 110 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q748K0 4.48e-28 110 34 1 189 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P47426 4.67e-28 110 36 3 161 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q927N9 5.41e-28 110 34 4 193 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q71WH8 6.01e-28 109 34 4 193 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q88XV2 6.33e-28 109 35 5 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8Y455 6.4e-28 109 34 4 193 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8DMY0 7.27e-28 109 35 5 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 7.27e-28 109 35 5 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8R7Y4 7.93e-28 109 33 4 198 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q48QM2 8.61e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 8.61e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 8.61e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
P0C0E9 8.88e-28 109 33 4 200 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 8.88e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 8.88e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 8.88e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 8.88e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 8.88e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 8.88e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 8.88e-28 109 33 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8VNL9 1.01e-27 108 36 3 181 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
Q73F66 1.06e-27 109 33 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9HPH7 1.18e-27 108 33 4 206 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q03ZL5 1.27e-27 108 33 4 196 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q2LY16 1.41e-27 108 34 2 179 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
Q1J982 1.49e-27 108 32 4 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7N0N3 1.49e-27 107 31 3 194 3 plu3849 Putative ABC transporter ATP-binding protein plu3849 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
O59479 1.7e-27 108 35 3 197 3 PH1815 Putative ABC transporter ATP-binding protein PH1815 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V2E4 1.74e-27 108 32 4 191 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q8TK65 1.81e-27 111 35 3 179 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q4A5A4 2.11e-27 108 32 6 212 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis synoviae (strain 53)
A0ALT6 2.26e-27 108 33 4 193 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q032H3 2.33e-27 108 40 3 155 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q97N51 2.47e-27 108 35 4 185 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q03ZL6 2.57e-27 107 36 2 166 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q3ABN1 2.74e-27 107 35 3 178 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8DWR3 2.98e-27 107 31 2 199 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 2.98e-27 107 31 2 199 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 2.98e-27 107 31 2 199 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q839D4 3.09e-27 108 36 5 183 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
A2RI02 3.16e-27 108 40 3 155 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q8PSR0 3.18e-27 111 32 5 215 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 2.54e-25 106 32 3 197 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q6G1D9 3.51e-27 106 32 5 192 3 BQ02700 Putative ABC transporter ATP-binding protein BQ02700 Bartonella quintana (strain Toulouse)
Q04EY5 4.28e-27 107 31 2 197 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8DRS0 4.44e-27 107 37 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q67JX4 4.67e-27 107 34 5 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A0R8K9 4.77e-27 107 32 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q9CIS8 5.24e-27 107 40 3 155 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q6HPM9 5.29e-27 107 32 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 5.29e-27 107 32 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q04FM1 5.77e-27 107 33 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q6GEL3 6.1e-27 106 31 4 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q2NIT5 8.9e-27 106 28 1 205 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q8TSC8 9.17e-27 110 31 4 214 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 2.33e-23 100 31 3 188 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 9.46e-27 110 32 4 208 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 1.84e-24 103 33 3 191 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8DWR4 1.09e-26 106 38 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 1.09e-26 106 38 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 1.09e-26 106 38 4 179 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q6G4Q8 1.14e-26 105 32 3 177 3 BH02760 Putative ABC transporter ATP-binding protein BH02760 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
O57872 1.33e-26 105 32 4 191 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q82HA2 1.4e-26 105 33 0 181 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9HMZ4 1.49e-26 105 32 3 208 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q73KT5 1.74e-26 105 33 3 189 3 TDE_2132 Putative ABC transporter ATP-binding protein TDE_2132 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5L3Q9 1.98e-26 105 33 5 198 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
Q5HDY6 2.07e-26 105 30 4 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 2.07e-26 105 30 4 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 2.07e-26 105 30 4 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q7A470 2.43e-26 105 31 5 210 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 2.43e-26 105 31 5 210 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YYM4 2.75e-26 105 30 4 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8R9L8 4.74e-26 108 31 4 206 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R9L8 3.54e-20 91 32 6 222 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q97WT4 4.86e-26 107 33 6 220 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97WT4 3.11e-08 56 29 5 208 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A3CRB9 5.05e-26 104 32 4 198 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
A3DJK3 5.59e-26 104 35 2 169 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q9RKC6 5.62e-26 103 34 3 188 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q73R11 5.93e-26 107 31 3 193 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73R11 5.52e-15 76 27 5 207 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q18CJ0 6.51e-26 104 35 4 181 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q8PUE7 6.58e-26 107 32 3 209 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 2.11e-19 89 27 3 201 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8NVB5 6.8e-26 103 30 4 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 6.8e-26 103 30 4 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q4A5A5 6.83e-26 103 30 3 184 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q38UT9 1.08e-25 103 34 4 191 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
A3CRB8 1.12e-25 103 34 4 184 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
O28437 1.18e-25 102 33 2 187 3 AF_1841 Putative ABC transporter ATP-binding protein AF_1841 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O34362 2.62e-25 105 32 2 199 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 3.24e-19 88 29 4 206 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q67JX3 2.67e-25 102 35 2 174 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q1WSB9 3.95e-25 102 33 5 196 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q9KGD6 4.72e-25 102 36 8 203 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8PVG9 4.97e-25 105 29 4 205 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 2.56e-24 103 33 3 197 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q97X60 6.89e-25 104 32 5 219 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97X60 1.08e-08 57 28 4 195 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q38UU0 7.91e-25 101 32 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8XHV2 8.86e-25 101 33 3 191 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain 13 / Type A)
Q0TMS7 8.86e-25 101 33 3 191 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SQH5 9.83e-25 101 32 3 197 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain SM101 / Type A)
Q88XV1 1.01e-24 101 33 5 198 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8TQW9 1.14e-24 103 31 5 214 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 3.9e-17 82 28 5 202 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PY26 2.07e-24 100 33 4 191 3 MM_1038 Putative ABC transporter ATP-binding protein MM_1038 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q6YR39 2.26e-24 100 29 1 194 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q03EE4 2.4e-24 100 29 2 202 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
D5AQY6 2.52e-24 99 32 4 217 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O29527 4.52e-24 99 30 4 191 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9CIS9 5.18e-24 99 31 3 187 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q032H4 6e-24 99 33 3 172 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 6e-24 99 33 3 172 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
P40735 7.15e-24 99 36 4 173 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q58967 7.77e-24 99 31 4 188 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q50294 9.28e-24 98 34 2 167 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q4L884 9.89e-24 98 33 6 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
Q63H61 1.19e-23 98 33 4 195 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q8ETV7 1.25e-23 98 34 7 200 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q65P77 2.98e-23 97 32 3 188 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A3DJK5 3.21e-23 97 29 4 192 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8U3E0 4.46e-23 96 30 5 203 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q035B3 5.26e-23 96 33 4 183 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q98QH4 5.59e-23 97 30 8 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q1WSB8 7.43e-23 96 30 5 208 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q8EUF1 8.08e-23 96 31 4 195 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Malacoplasma penetrans (strain HF-2)
Q8TI15 8.83e-23 96 34 5 183 3 MA_4342 Putative ABC transporter ATP-binding protein MA_4342 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q2RFS8 9.74e-23 95 34 2 183 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9WY65 1.98e-22 94 32 5 192 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q83CV2 2.36e-22 94 33 7 203 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q7A088 2.79e-22 94 30 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 2.79e-22 94 30 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 2.79e-22 94 30 6 197 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 2.79e-22 94 30 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 2.79e-22 94 30 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 2.79e-22 94 30 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 2.79e-22 94 30 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
Q2YYM5 2.88e-22 94 30 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GEL4 3.06e-22 94 30 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q5FM62 3.34e-22 94 34 3 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q04BY6 3.75e-22 94 39 4 158 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBI9 3.75e-22 94 39 4 158 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q7NNW9 5.38e-22 93 40 3 189 3 gll0289 Putative ABC transporter ATP-binding protein gll0289 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q93D97 5.6e-22 96 28 4 210 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 7.64e-14 73 27 3 191 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6KHL2 8.68e-22 94 28 6 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q4L885 1.02e-21 93 30 0 169 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
P47425 1.13e-21 93 31 4 180 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q73P93 1.16e-21 95 29 3 197 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 1.91e-10 63 26 8 199 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q82B58 1.28e-21 95 29 5 208 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q82B58 9.3e-18 84 30 5 210 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5L3R0 1.42e-21 92 35 4 169 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
Q6F1W4 1.97e-21 93 32 6 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q897I2 2.08e-21 94 29 4 192 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 7.72e-07 52 27 1 111 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q49ZD9 2.57e-21 92 30 5 184 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6XYZ4 3.38e-21 92 33 4 175 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Spiroplasma kunkelii
Q74L62 4.11e-21 91 31 3 185 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q2KBP5 4.68e-21 90 34 4 179 1 bioM Biotin transport ATP-binding protein BioM Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8TI16 4.93e-21 91 32 6 196 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PY27 5.75e-21 91 32 3 182 3 MM_1037 Putative ABC transporter ATP-binding protein MM_1037 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q6F1W5 6.18e-21 92 30 4 188 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q927N8 6.44e-21 91 37 2 151 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q0AUL1 6.61e-21 90 34 1 168 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q8Y454 6.99e-21 90 37 2 151 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P27675 7.15e-21 90 31 7 195 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
O34677 8.02e-21 90 30 7 199 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q11JI6 8.28e-21 89 33 6 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Chelativorans sp. (strain BNC1)
Q4AA74 8.41e-21 91 31 6 204 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q601T6 8.41e-21 91 31 6 204 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 232)
Q8REG7 1.01e-20 90 28 6 223 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q88ZZ2 1.19e-20 92 31 3 202 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 4e-19 88 28 3 184 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q4A8A1 1.43e-20 90 31 6 204 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 7448)
Q92CK1 1.48e-20 89 30 3 184 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q04BY7 1.82e-20 90 32 4 186 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
P54537 1.93e-20 89 27 6 209 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q03PY6 2.21e-20 89 34 7 193 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A0ALT7 2.27e-20 89 37 2 151 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q6MSQ2 2.28e-20 90 32 4 181 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q9KXJ6 2.42e-20 92 28 4 206 3 SCO2324 Putative ABC transporter ATP-binding protein SCO2324 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KXJ6 8.96e-18 84 30 6 207 3 SCO2324 Putative ABC transporter ATP-binding protein SCO2324 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2SRI2 2.48e-20 89 33 5 184 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6G3A6 2.49e-20 88 33 7 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q18C09 2.5e-20 90 28 4 208 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q8CRI6 2.53e-20 89 31 3 191 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM27 2.53e-20 89 31 3 191 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9Z9J3 2.56e-20 89 33 2 183 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q71WH7 2.6e-20 89 37 2 151 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q1CI46 3e-20 88 33 10 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFR4 3e-20 88 33 10 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q1C6Q8 3e-20 88 33 10 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
Q1GBJ0 3.45e-20 89 32 4 186 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q81PZ8 3.74e-20 91 30 3 196 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 7.85e-13 70 24 3 212 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q6HI76 3.77e-20 91 30 3 196 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 3.13e-12 68 25 6 220 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q669P3 3.82e-20 88 33 10 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q5FM63 6.1e-20 88 32 5 187 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q88CL2 7.3e-20 89 34 9 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q31GF5 7.51e-20 87 31 8 208 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q57243 7.7e-20 87 33 5 199 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9RRL9 7.96e-20 87 30 4 193 3 DR_2469 Putative ABC transporter ATP-binding protein DR_2469 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q0SVB6 8.43e-20 87 27 6 224 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain SM101 / Type A)
Q8XMP8 8.43e-20 87 27 6 224 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain 13 / Type A)
Q0TTG6 8.43e-20 87 27 6 224 3 pstB Phosphate import ATP-binding protein PstB Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q972J5 8.99e-20 90 30 2 189 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q972J5 1.54e-10 63 32 5 175 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q8Y7R4 9.65e-20 87 31 2 179 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8ES39 1.05e-19 90 26 1 204 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 1.46e-14 75 28 4 216 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P55662 1.45e-19 87 28 6 207 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q720M2 1.47e-19 87 31 2 179 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q98QH5 1.53e-19 87 33 4 169 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q65TB7 1.66e-19 86 29 5 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q737I0 1.75e-19 89 27 2 193 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 1.9e-15 77 25 3 212 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q92VJ2 1.82e-19 88 31 6 211 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q6KHL1 2.01e-19 87 27 3 185 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q66D26 2.62e-19 86 29 9 229 3 phnC Phosphonates import ATP-binding protein PhnC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CFV9 2.62e-19 86 29 9 229 3 phnC Phosphonates import ATP-binding protein PhnC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZGU5 2.62e-19 86 29 9 229 3 phnC Phosphonates import ATP-binding protein PhnC Yersinia pestis
Q1C9L0 2.62e-19 86 29 9 229 3 phnC Phosphonates import ATP-binding protein PhnC Yersinia pestis bv. Antiqua (strain Antiqua)
Q81GC1 2.92e-19 87 32 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q73L25 3.16e-19 85 36 5 167 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q89UD2 3.43e-19 87 33 10 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P45092 3.46e-19 85 27 6 214 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q92QN0 4.34e-19 85 33 6 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rhizobium meliloti (strain 1021)
Q8G195 4.73e-19 85 34 7 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella suis biovar 1 (strain 1330)
Q8YGM0 4.73e-19 85 34 7 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57DS9 4.73e-19 85 34 7 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella abortus biovar 1 (strain 9-941)
Q2YNH6 4.73e-19 85 34 7 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella abortus (strain 2308)
Q9CN78 4.88e-19 85 29 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
Q8CRI7 5.45e-19 85 28 5 183 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM28 6.16e-19 85 28 5 183 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q21JQ9 6.38e-19 84 29 6 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1VZQ5 6.47e-19 85 26 5 209 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q8E3S6 6.73e-19 87 26 3 206 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S6 1.02e-12 69 28 3 187 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8DY60 6.73e-19 87 26 3 206 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 9.01e-13 69 28 3 187 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q5ZWE4 7.07e-19 86 31 8 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q3YSY7 7.19e-19 84 31 10 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ehrlichia canis (strain Jake)
Q04EY4 7.31e-19 85 29 4 198 3 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8F6Z1 8.39e-19 86 29 6 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 8.39e-19 86 29 6 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q9I6L0 8.46e-19 86 33 9 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q16BJ3 1.01e-18 85 33 9 204 3 tauB Taurine import ATP-binding protein TauB Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q0P9X7 1.11e-18 84 26 5 209 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q110U3 1.25e-18 86 32 6 191 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q5X627 1.3e-18 85 30 6 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q8H1R4 1.31e-18 84 35 5 175 1 ABCI10 ABC transporter I family member 10 Arabidopsis thaliana
Q1WVI7 1.32e-18 85 28 6 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q87G35 1.47e-18 86 25 2 212 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 3.17e-17 82 29 5 200 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q63E84 1.5e-18 85 31 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 1.5e-18 85 31 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 1.5e-18 85 31 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q8YQ88 1.59e-18 84 28 3 180 3 alr3946 Putative ABC transporter ATP-binding protein alr3946 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q6HLQ9 1.61e-18 85 31 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q5WXF0 1.65e-18 85 31 8 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q8XK20 1.75e-18 86 29 3 186 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 3.52e-18 85 26 2 197 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q5QU46 1.98e-18 83 32 5 190 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P45769 2.07e-18 84 26 5 215 3 yhdZ Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ Escherichia coli (strain K12)
Q9X1Z1 2.11e-18 84 29 2 199 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q52666 2.18e-18 84 26 5 208 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q81TH8 2.41e-18 84 32 8 194 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
Q88ZJ6 2.5e-18 85 28 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9PPV1 2.51e-18 84 32 2 166 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q65UE1 2.71e-18 85 29 7 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8UFV7 2.77e-18 83 32 6 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8R9I2 3.07e-18 83 28 6 206 3 pstB2 Phosphate import ATP-binding protein PstB 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6FZX3 3.08e-18 82 31 6 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bartonella quintana (strain Toulouse)
Q15QL7 3.2e-18 84 28 7 220 3 pstB Phosphate import ATP-binding protein PstB Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7NAQ6 3.32e-18 84 27 3 188 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q0I3C2 3.41e-18 82 28 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Histophilus somni (strain 129Pt)
Q92XW1 3.69e-18 84 30 5 210 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q7NAQ7 3.74e-18 84 28 5 199 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q4AA75 3.76e-18 83 29 4 194 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q4A8A2 4.12e-18 83 29 4 194 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 7448)
Q601T5 4.12e-18 83 29 4 194 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 232)
Q97SA3 4.53e-18 85 25 2 191 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97SA3 9.36e-15 75 28 6 214 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q3JYY5 4.64e-18 82 29 7 209 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8RQL7 4.93e-18 82 29 5 193 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P37774 4.97e-18 82 29 6 214 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
P63372 5.16e-18 82 29 7 209 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63371 5.16e-18 82 29 7 209 3 pstB3 Phosphate import ATP-binding protein PstB 3 Streptococcus agalactiae serotype III (strain NEM316)
P0AAF9 5.93e-18 82 31 7 196 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF6 5.93e-18 82 31 7 196 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF7 5.93e-18 82 31 7 196 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF8 5.93e-18 82 31 7 196 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
Q97IE0 6.07e-18 82 28 6 207 3 pstB Phosphate import ATP-binding protein PstB Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q03AH0 6.35e-18 84 28 4 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q9TKX3 6.69e-18 84 30 5 206 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q2K9R2 7.13e-18 82 32 7 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q3A9G5 7.35e-18 83 27 8 214 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P45247 7.67e-18 82 28 5 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 7.67e-18 82 28 5 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
Q5ZT78 8.25e-18 81 31 7 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X2Z8 8.42e-18 81 32 7 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Paris)
Q4FTM3 8.44e-18 81 34 7 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q8XBJ8 8.76e-18 83 29 8 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
P45022 8.82e-18 82 27 6 215 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3B276 8.95e-18 82 33 8 198 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P44513 9.21e-18 83 32 7 216 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P16676 1.03e-17 83 29 8 221 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8FFB3 1.04e-17 83 29 8 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7UC29 1.09e-17 83 29 8 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q05596 1.15e-17 82 28 4 197 1 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8DQY5 1.19e-17 84 24 3 211 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 1.33e-14 75 29 5 203 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8D3Z9 1.29e-17 84 26 5 214 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 6.26e-16 79 31 3 175 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8Y0X3 1.33e-17 83 32 6 193 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q729H7 1.39e-17 81 31 8 220 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q04G50 1.39e-17 83 28 5 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q4QP85 1.44e-17 82 32 7 216 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
O86751 1.63e-17 82 30 4 207 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8Z5N5 1.64e-17 81 28 4 197 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhi
Q32EX7 1.67e-17 80 30 9 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q5PDU4 1.76e-17 81 28 4 197 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0I3Y9 1.86e-17 82 29 7 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q13VD7 1.91e-17 82 30 7 213 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
A0PY57 1.92e-17 82 27 7 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q5FUV5 2.05e-17 80 31 7 210 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Gluconobacter oxydans (strain 621H)
P40860 2.08e-17 82 30 7 204 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z4V6 2.1e-17 82 30 7 204 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q8X8E3 2.19e-17 80 30 9 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O157:H7
Q6D664 2.31e-17 80 32 11 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3Z300 2.35e-17 80 30 9 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 2.35e-17 80 30 9 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 2.35e-17 80 30 9 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 2.35e-17 80 30 9 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P75957 2.58e-17 80 30 9 218 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
Q6GH21 2.67e-17 81 28 8 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MRSA252)
Q8UH62 2.69e-17 82 30 6 211 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q818I7 2.73e-17 81 28 7 212 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q7VMV4 2.84e-17 80 29 8 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6HDP8 2.84e-17 81 28 7 212 3 pstB Phosphate import ATP-binding protein PstB Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634R8 2.84e-17 81 28 7 212 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ZK / E33L)
Q730R7 2.84e-17 81 28 7 212 3 pstB Phosphate import ATP-binding protein PstB Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81LW6 2.84e-17 81 28 7 212 3 pstB Phosphate import ATP-binding protein PstB Bacillus anthracis
Q1JII9 2.87e-17 82 27 5 204 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q4KFA2 2.92e-17 80 32 7 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q82WT5 2.93e-17 82 30 5 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2YXY2 2.95e-17 81 28 8 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7MFH3 2.98e-17 82 24 3 213 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 3.19e-15 77 30 3 175 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q1B8V9 2.98e-17 82 29 7 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 2.98e-17 82 29 7 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
P69880 3.01e-17 81 28 9 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MW2)
Q6G9H4 3.01e-17 81 28 9 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain MSSA476)
P69879 3.01e-17 81 28 9 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain N315)
P69878 3.01e-17 81 28 9 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain Mu50 / ATCC 700699)
P69881 3.01e-17 81 28 9 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain COL)
Q2FYQ0 3.01e-17 81 28 9 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH51 3.01e-17 81 28 9 215 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus aureus (strain USA300)
Q38VW6 3.1e-17 82 27 4 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q5PBX2 3.1e-17 80 31 7 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Anaplasma marginale (strain St. Maries)
Q48V78 3.11e-17 82 27 5 204 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 3.11e-17 82 27 5 204 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q83F44 3.13e-17 82 30 4 192 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q6N9W0 3.25e-17 82 30 7 206 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q04F14 3.53e-17 82 24 5 218 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q3KJQ7 3.64e-17 80 32 5 168 3 tauB Taurine import ATP-binding protein TauB Pseudomonas fluorescens (strain Pf0-1)
Q98KS7 3.75e-17 80 31 6 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P14788 3.76e-17 81 30 6 207 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5WUF8 3.82e-17 80 31 7 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Lens)
Q03ZQ0 3.99e-17 82 29 5 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
P73265 4.11e-17 80 30 6 211 3 nrtD Nitrate import ATP-binding protein NrtD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q57QD7 4.24e-17 80 32 11 221 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q5HC57 4.27e-17 79 32 9 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ehrlichia ruminantium (strain Welgevonden)
Q5FFC0 4.27e-17 79 32 9 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ehrlichia ruminantium (strain Gardel)
Q87J32 4.3e-17 80 29 5 208 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6G2E2 4.36e-17 81 28 5 194 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q49ZE0 4.7e-17 80 30 2 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8RHK9 4.78e-17 80 31 6 201 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q88AS5 4.87e-17 81 33 9 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1MIJ4 5.37e-17 79 31 7 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P61482 5.71e-17 79 32 11 221 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 5.71e-17 79 32 11 221 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 5.71e-17 79 32 11 221 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1QCN2 5.98e-17 79 33 7 193 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1J8E4 6.11e-17 81 26 5 204 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q6MSQ1 6.17e-17 81 30 2 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q6NBT1 6.38e-17 81 29 7 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5FA19 6.91e-17 81 31 5 212 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P77279 7e-17 79 32 6 206 1 fetA Probable iron export ATP-binding protein FetA Escherichia coli (strain K12)
P0AAG3 7.01e-17 79 29 7 210 3 gltL Glutamate/aspartate import ATP-binding protein GltL Escherichia coli (strain K12)
P0AAG4 7.01e-17 79 29 7 210 3 gltL Glutamate/aspartate import ATP-binding protein GltL Escherichia coli O157:H7
P10346 8.38e-17 79 29 7 212 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q6YRJ4 8.6e-17 81 25 4 212 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6YRJ4 1.68e-14 75 24 3 189 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q7N6Z2 9.05e-17 80 29 8 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q87UH7 1.01e-16 79 31 5 170 3 tauB Taurine import ATP-binding protein TauB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
O31723 1.02e-16 79 28 6 215 2 ylmA Uncharacterized ABC transporter ATP-binding protein YlmA Bacillus subtilis (strain 168)
P75370 1.03e-16 79 23 3 223 3 p29 Probable ABC transporter ATP-binding protein p29 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2SRI1 1.11e-16 80 30 2 165 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q97KD5 1.12e-16 80 25 4 208 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9X0Y8 1.13e-16 79 27 7 210 3 pstB Phosphate import ATP-binding protein PstB Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1TXH7 1.16e-16 80 31 9 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q4L691 1.19e-16 79 29 8 208 3 pstB Phosphate import ATP-binding protein PstB Staphylococcus haemolyticus (strain JCSC1435)
Q1JNE0 1.26e-16 80 26 5 204 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 1.26e-16 80 26 5 204 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q160M2 1.28e-16 80 31 6 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8NQU4 1.32e-16 79 25 6 204 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P63363 1.32e-16 79 26 6 206 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71WT3 1.32e-16 79 26 6 206 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria monocytogenes serotype 4b (strain F2365)
P63364 1.32e-16 79 26 6 206 3 pstB1 Phosphate import ATP-binding protein PstB 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P63368 1.33e-16 79 29 8 222 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63367 1.33e-16 79 29 8 222 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype III (strain NEM316)
Q3K199 1.33e-16 79 29 8 222 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5XDS8 1.35e-16 80 26 5 204 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8DU24 1.39e-16 79 28 8 222 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8ELT4 1.4e-16 79 28 8 209 3 pstB Phosphate import ATP-binding protein PstB Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8DQH4 1.46e-16 78 26 8 215 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 1.46e-16 78 26 8 215 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q045Z8 1.52e-16 79 29 2 178 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q9PPV2 1.64e-16 80 40 1 98 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q5NZT6 1.77e-16 78 31 5 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q1WVG9 1.89e-16 79 27 6 200 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q87EF4 1.93e-16 78 30 8 218 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q2GHT4 1.95e-16 78 31 10 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
O28912 1.98e-16 78 27 8 218 3 pstB Phosphate import ATP-binding protein PstB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8X5I6 1.99e-16 78 27 6 218 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O157:H7
Q52815 2.01e-16 78 27 5 194 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q88KY4 2.01e-16 78 31 6 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q81CT8 2.1e-16 80 29 3 187 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 3.22e-13 71 24 5 202 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5E0B3 2.13e-16 78 29 6 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q38WL5 2.14e-16 79 29 8 212 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
P44871 2.26e-16 77 29 6 205 3 ftsE Cell division ATP-binding protein FtsE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1IGM2 2.29e-16 78 33 7 171 3 tauB Taurine import ATP-binding protein TauB Pseudomonas entomophila (strain L48)
Q8P8V9 2.31e-16 78 31 7 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UV71 2.31e-16 78 31 7 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas campestris pv. campestris (strain 8004)
P0A2V2 2.32e-16 78 26 6 224 2 occP Octopine permease ATP-binding protein P Rhizobium radiobacter
P0A2V3 2.32e-16 78 26 6 224 3 occP Octopine permease ATP-binding protein P Agrobacterium tumefaciens (strain Ach5)
Q7MJ01 2.35e-16 77 30 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio vulnificus (strain YJ016)
Q8DAV6 2.35e-16 77 30 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio vulnificus (strain CMCP6)
Q87R20 2.4e-16 78 30 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q88WA5 2.41e-16 79 28 6 195 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16925
Feature type CDS
Gene -
Product ABC transporter ATP-binding protein
Location 7308 - 7952 (strand: 1)
Length 645 (nucleotides) / 214 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2873
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1122 Inorganic ion transport and metabolism (P)
General function prediction only (R)
PR Energy-coupling factor transporter ATP-binding protein EcfA2

Protein Sequence

MTPQSPLVQVKNLVVRRNTAPIIQDLNFDLNAGERLFLCGDIGSGKSTLLHTLLGFIPFSGEITVFDQRRQSEDDFTEIRGPLGLLFQHPDDQLFGPGVLDDVMFGPLNMGMTPDEARERAIACLEMLDIIHLKDRAVTEISGGEKNFTALAGVLAMSPSVLLLDEPTNGLNEKNIQRLENILRELNLPMIVASHNRQFTESMAHRIIPFPCRP

Flanking regions ( +/- flanking 50bp)

CCGTGGTTTCTATGCGCGTCCATCTTCAATTACGACAAAAAGGTGTGTTAATGACTCCCCAAAGCCCGTTAGTTCAGGTCAAAAACCTTGTTGTCCGTCGCAACACTGCGCCGATAATTCAGGATCTGAACTTTGACCTGAACGCCGGAGAACGATTGTTCCTGTGTGGTGATATCGGCAGCGGGAAATCCACCCTGTTACATACCCTGCTCGGCTTTATTCCGTTCAGTGGTGAAATCACTGTATTTGACCAGCGTCGTCAGTCAGAAGATGATTTTACAGAAATCCGCGGTCCGCTGGGATTATTGTTCCAGCATCCTGACGACCAGCTATTTGGTCCTGGCGTACTGGATGATGTGATGTTCGGCCCGCTGAATATGGGAATGACACCGGATGAAGCGCGTGAACGCGCCATCGCCTGCCTGGAAATGCTGGATATTATCCATCTGAAAGACCGGGCGGTGACGGAGATCTCAGGGGGCGAGAAAAACTTTACCGCGCTGGCAGGTGTACTTGCCATGTCGCCGTCAGTATTGCTGCTGGATGAACCGACTAATGGTCTGAATGAGAAGAATATTCAGCGGCTGGAAAATATTCTCCGCGAACTGAATCTGCCGATGATTGTCGCCTCCCATAACAGGCAGTTTACTGAGTCAATGGCACACAGGATAATCCCGTTTCCCTGCCGTCCCTGAAAACCTGATTCAGATAATCAAAAAGCCGATCAATATAAAATGATCGGCTT