Homologs in group_1354

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07940 FBDBKF_07940 100.0 Morganella morganii S1 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
EHELCC_13770 EHELCC_13770 100.0 Morganella morganii S2 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
LHKJJB_08635 LHKJJB_08635 100.0 Morganella morganii S3 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
HKOGLL_08185 HKOGLL_08185 100.0 Morganella morganii S5 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
F4V73_RS13045 F4V73_RS13045 91.9 Morganella psychrotolerans - response regulator transcription factor
PMI_RS00930 PMI_RS00930 71.3 Proteus mirabilis HI4320 - response regulator transcription factor

Distribution of the homologs in the orthogroup group_1354

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1354

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P27667 8.05e-59 186 49 3 201 3 uhpA Transcriptional regulatory protein UhpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AGA9 8.91e-57 181 48 3 199 3 uhpA Transcriptional regulatory protein UhpA Shigella flexneri
P0AGA6 8.91e-57 181 48 3 199 1 uhpA Transcriptional regulatory protein UhpA Escherichia coli (strain K12)
P0AGA7 8.91e-57 181 48 3 199 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGA8 8.91e-57 181 48 3 199 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O157:H7
Q7WZY4 1.36e-32 120 32 2 215 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
Q4L8Q6 1.31e-31 117 32 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus haemolyticus (strain JCSC1435)
P0AED6 1.7e-31 117 31 2 209 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 1.7e-31 117 31 2 209 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
P66797 2.08e-31 117 31 2 209 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 2.08e-31 117 31 2 209 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q8CN75 4.65e-31 116 31 2 216 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLK6 4.8e-31 115 31 2 216 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P13800 3.27e-30 114 35 2 208 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
O07528 6.25e-30 113 34 3 210 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P54662 6.95e-30 113 32 2 209 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
Q1M7A0 1.12e-29 112 32 3 207 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P9WMF9 2.64e-29 111 34 1 204 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 2.64e-29 111 34 1 204 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7A029 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MW2)
A8Z580 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6T0 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MSSA476)
Q7A3U5 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain N315)
Q99RN8 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJN1 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Newman)
Q5HDG5 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain COL)
A5IVH2 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH9)
Q2FVM7 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEA6 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300)
A6U4C0 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH1)
A7X623 3.14e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE42 3.68e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MRSA252)
Q2YZ42 3.68e-29 111 30 2 215 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain bovine RF122 / ET3-1)
P44845 5.75e-28 107 32 0 193 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31802 9.9e-28 107 33 1 196 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
Q52376 1.56e-27 106 30 2 210 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
P95582 2.5e-27 106 30 2 210 3 gacA Response regulator GacA Pseudomonas viridiflava
P24908 5.06e-27 105 33 3 209 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AF31 6.21e-27 105 34 2 184 3 narL Nitrate/nitrite response regulator protein NarL Shigella flexneri
P0AF28 6.21e-27 105 34 2 184 1 narL Nitrate/nitrite response regulator protein NarL Escherichia coli (strain K12)
P0AF29 6.21e-27 105 34 2 184 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AF30 6.21e-27 105 34 2 184 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O157:H7
Q51373 8.87e-27 104 31 4 211 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7A0I0 3.35e-26 103 29 1 206 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 3.35e-26 103 29 1 206 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 3.35e-26 103 29 1 206 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 3.35e-26 103 29 1 206 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 3.35e-26 103 29 1 206 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 3.35e-26 103 29 1 206 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P32967 8.1e-26 102 30 1 209 1 gacA Response regulator GacA Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P94439 1.98e-25 101 31 2 201 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
P55184 5.08e-25 100 30 4 215 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
P0ACZ7 5.22e-25 100 29 1 195 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 5.22e-25 100 29 1 195 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 5.22e-25 100 29 1 195 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 5.22e-25 100 29 1 195 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
O34723 1.12e-24 99 31 3 198 1 desR Transcriptional regulatory protein DesR Bacillus subtilis (strain 168)
A8R3S7 1.66e-24 99 33 1 210 2 exaE Transcriptional activator protein ExaE Pseudomonas putida
P26319 4.96e-24 97 27 1 205 3 fimZ Fimbriae Z protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEL8 1.15e-23 96 27 3 206 3 fimZ Fimbriae Z protein Escherichia coli (strain K12)
P0AEL9 1.15e-23 96 27 3 206 3 fimZ Fimbriae Z protein Escherichia coli O157:H7
Q7CQM5 4.01e-23 95 30 2 202 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O32197 1.08e-22 94 29 1 210 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
P56644 3.28e-22 92 31 1 191 3 sgaR Probable transcriptional regulatory protein SgaR Hyphomicrobium methylovorum
P0A4H2 2.38e-21 90 27 3 207 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 2.38e-21 90 27 3 207 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 2.38e-21 90 27 3 207 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
O07019 9.04e-21 89 28 2 201 3 yvfU Uncharacterized transcriptional regulatory protein YvfU Bacillus subtilis (strain 168)
Q5HEP0 2.41e-19 85 29 1 206 3 vraR Response regulator protein VraR Staphylococcus aureus (strain COL)
Q2FX09 2.41e-19 85 29 1 206 1 vraR Response regulator protein VraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
P29904 2.86e-19 85 31 4 201 4 moxX Methanol utilization control regulatory protein MoxX Paracoccus denitrificans
P96686 3.73e-19 84 26 2 211 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P10958 4.53e-19 84 33 8 203 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
Q49YS9 6.25e-19 84 28 1 206 3 vraR Response regulator protein VraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CNP9 7.16e-19 84 28 1 206 3 vraR Response regulator protein VraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN50 7.16e-19 84 28 1 206 3 vraR Response regulator protein VraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L7J5 4.15e-18 82 29 1 206 3 vraR Response regulator protein VraR Staphylococcus haemolyticus (strain JCSC1435)
Q56127 1.61e-17 80 25 1 201 3 rcsB Transcriptional regulatory protein RcsB Salmonella typhi
P23221 1.89e-17 80 28 6 210 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P69410 2.64e-17 80 24 1 201 3 rcsB Transcriptional regulatory protein RcsB Shigella flexneri
P0DMC8 2.64e-17 80 24 1 201 1 rcsB Transcriptional regulatory protein RcsB Escherichia coli
P0DMC7 2.64e-17 80 24 1 201 1 rcsB Transcriptional regulatory protein RcsB Escherichia coli (strain K12)
P69408 2.64e-17 80 24 1 201 3 rcsB Transcriptional regulatory protein RcsB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69409 2.64e-17 80 24 1 201 3 rcsB Transcriptional regulatory protein RcsB Escherichia coli O157:H7
P58663 3.03e-17 79 24 1 201 1 rcsB Transcriptional regulatory protein RcsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P9WGM5 7.02e-17 79 27 2 211 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 7.02e-17 79 27 2 211 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O87940 2.45e-16 77 30 4 201 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
P72781 2.49e-15 75 29 4 226 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P26487 5.5e-15 73 31 4 201 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P48359 1.03e-13 70 26 5 214 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
Q1XDE4 2.85e-12 66 25 6 206 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P58664 4.51e-12 65 28 5 203 4 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli O157:H7
Q3LWR6 1.16e-11 65 30 4 167 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 1.16e-11 65 30 4 167 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 1.16e-11 65 30 4 167 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P14204 3.2e-11 63 22 4 210 1 comA Transcriptional regulatory protein ComA Bacillus subtilis (strain 168)
Q46791 5.39e-11 61 35 1 108 1 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli (strain K12)
Q8KR08 2.3e-10 61 30 3 148 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P29369 2.19e-09 58 26 2 155 3 agmR Glycerol metabolism activator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1IRH0 2.35e-09 59 33 1 119 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q52883 7.02e-09 58 40 0 67 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
O31517 7.1e-09 58 25 1 119 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
P30843 7.19e-09 57 29 1 117 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
A8R3T0 7.41e-09 57 22 3 219 3 agmR Glycerol metabolism activator Pseudomonas putida
Q8EDD7 1.2e-08 56 30 2 120 3 SO_2823 Uncharacterized response regulatory protein SO_2823 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P36556 1.66e-08 56 28 1 117 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P06534 3.96e-08 55 30 1 119 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
O34903 4.88e-08 54 31 4 134 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q7CQM8 9.5e-08 53 26 6 208 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O83639 9.86e-08 54 30 1 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q3SVA1 1.06e-07 54 30 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1W0A5 1.18e-07 52 30 4 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.18e-07 52 30 4 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.18e-07 52 30 4 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P0A4I4 1.21e-07 53 29 1 119 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 1.21e-07 53 29 1 119 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A1SMR4 1.27e-07 54 30 2 121 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q8EEQ0 1.29e-07 54 34 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9KU36 1.33e-07 53 31 2 116 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P52942 1.37e-07 52 26 1 115 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
P52932 1.47e-07 53 27 2 119 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
Q2YC79 1.63e-07 53 34 2 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P96126 2.11e-07 51 27 3 120 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q56312 2.25e-07 51 25 1 118 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q39S45 2.55e-07 53 32 2 127 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
L7N689 2.63e-07 53 30 2 134 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P15940 2.66e-07 52 27 6 172 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P45671 2.97e-07 53 30 5 158 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q2FQU2 3.04e-07 53 34 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q06239 3.75e-07 52 29 3 115 3 vanR Regulatory protein VanR Enterococcus faecium
Q2FMT2 4.04e-07 52 29 1 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
P62646 5.17e-07 52 26 1 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P44918 5.41e-07 52 31 2 116 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8ZNN2 6.02e-07 52 30 2 120 3 btsR Transcriptional regulatory protein BtsR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q88RJ6 6.47e-07 52 30 1 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8Z5C1 7.23e-07 51 30 2 120 3 btsR Transcriptional regulatory protein BtsR Salmonella typhi
Q7NV40 7.52e-07 52 30 2 125 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8ZBV2 8.3e-07 51 32 2 104 3 YPO3287 Uncharacterized response regulatory protein YPO3287/y0902/YP_0397 Yersinia pestis
P52928 9.11e-07 51 28 1 119 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
Q1QI44 9.81e-07 52 27 1 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
P37740 1.23e-06 50 28 5 163 3 dctR C4-dicarboxylate transport transcriptional regulatory protein DctR Rhodobacter capsulatus
Q2KCH8 1.32e-06 51 34 0 67 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2FWH6 1.41e-06 50 26 4 164 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q81JL3 1.44e-06 50 26 1 115 3 lytT Sensory transduction protein LytT Bacillus anthracis
Q9HV32 1.73e-06 50 29 3 164 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88AQ2 1.76e-06 51 29 1 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P0A9Q4 1.79e-06 50 31 3 116 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 1.79e-06 50 31 3 116 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 1.79e-06 50 31 3 116 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 1.79e-06 50 31 3 116 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
O85128 1.81e-06 50 31 0 69 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2RX18 2.27e-06 50 32 1 112 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P72253 2.29e-06 50 29 1 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
P23747 2.76e-06 50 29 1 109 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2WAJ8 3.04e-06 50 31 1 116 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q814J1 3.4e-06 49 26 1 115 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q1MLG8 3.59e-06 50 32 0 67 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P52931 4.07e-06 49 22 1 144 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P0A4H5 4.44e-06 47 23 1 117 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 4.44e-06 47 23 1 117 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q04848 4.58e-06 50 34 0 82 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q10WZ6 5.41e-06 49 28 1 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q8DET1 7e-06 48 28 2 124 3 VV1_0503 Uncharacterized response regulatory protein VV1_0503 Vibrio vulnificus (strain CMCP6)
P52934 7e-06 48 24 2 142 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
P0AFT5 7.21e-06 48 29 2 104 1 btsR Transcriptional regulatory protein BtsR Escherichia coli (strain K12)
P0AFT6 7.21e-06 48 29 2 104 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0DUE6 7.21e-06 48 29 2 104 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O157:H7
P0DUE7 7.21e-06 48 29 2 104 4 btsR Transcriptional regulatory protein-like BtsR Enterobacteria phage VT1-Sakai
Q82Z76 7.69e-06 48 24 2 139 4 lytT Sensory transduction protein LytT Enterococcus faecalis (strain ATCC 700802 / V583)
P96602 8.94e-06 48 24 0 118 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P59640 9.42e-06 48 29 2 104 3 btsR Transcriptional regulatory protein BtsR Shigella flexneri
P62644 1.04e-05 48 28 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B0R4K1 1.17e-05 46 25 1 116 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P10576 1.32e-05 48 29 2 113 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q2NB98 1.33e-05 47 40 0 59 1 ELI_04755 Light-activated DNA-binding protein EL222 Erythrobacter litoralis (strain HTCC2594)
Q132U2 1.36e-05 48 27 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain BisB5)
A0R3I8 1.38e-05 47 29 1 117 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q1GZZ0 1.76e-05 48 26 1 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0A9Z5 1.79e-05 48 28 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
O34534 1.8e-05 47 29 0 115 1 citT Transcriptional regulatory protein CitT Bacillus subtilis (strain 168)
Q0AYL3 2.09e-05 47 25 5 165 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
O69730 2.12e-05 47 32 3 112 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8TUQ0 2.18e-05 47 22 3 163 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P9WGN1 2.22e-05 47 37 2 90 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 2.22e-05 47 37 2 90 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8GP20 2.24e-05 47 30 0 84 1 rssB Swarming motility regulation protein RssB Serratia marcescens
P10577 2.26e-05 47 30 2 110 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q7D9K0 2.27e-05 47 27 3 145 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 2.27e-05 47 27 3 145 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P45785 2.28e-05 47 39 0 64 4 None Putative HTH-type transcriptional regulator in exeN 3'region (Fragment) Aeromonas salmonicida
Q70FH0 2.54e-05 47 34 0 85 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
P51586 2.65e-05 45 29 2 118 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q4L6C6 2.66e-05 47 29 4 121 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P39663 2.89e-05 47 28 5 175 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P51343 2.97e-05 46 24 3 177 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
P26275 3.08e-05 47 30 4 126 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2LR65 3.48e-05 47 29 1 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
P10046 3.6e-05 47 28 8 203 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P11470 3.84e-05 43 51 0 43 1 gerE Spore germination protein GerE Bacillus subtilis (strain 168)
Q1LH11 4.01e-05 47 26 1 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3ADA6 4.06e-05 47 26 3 152 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8F3H4 4.37e-05 47 33 0 75 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62643 4.37e-05 47 33 0 75 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
O05251 4.55e-05 46 28 0 104 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q48ND9 5.02e-05 46 26 6 187 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8EF61 5.06e-05 46 27 1 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7A1J1 5.29e-05 46 28 2 114 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 5.29e-05 46 28 2 114 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 5.29e-05 46 28 2 114 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 5.29e-05 46 28 2 114 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 5.29e-05 46 28 2 114 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 5.29e-05 46 28 2 114 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 5.29e-05 46 28 2 114 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 5.29e-05 46 28 2 114 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 5.29e-05 46 28 2 114 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 5.29e-05 46 28 2 114 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
A1TEL7 5.38e-05 46 29 1 117 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q89T55 5.61e-05 46 28 2 115 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P9WGM3 6.14e-05 45 27 4 115 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 6.14e-05 45 27 4 115 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6GK51 6.2e-05 46 28 2 117 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
Q2YV67 6.2e-05 46 28 2 117 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P38684 6.23e-05 45 29 2 115 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
Q8NYH3 6.38e-05 46 28 2 117 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 6.38e-05 46 28 2 117 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
P60610 6.44e-05 45 28 2 117 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 6.44e-05 45 28 2 117 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 6.44e-05 45 28 2 117 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 6.44e-05 45 28 2 117 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 6.44e-05 45 28 2 117 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q9WYN9 6.62e-05 46 29 2 109 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q1B3X8 6.78e-05 45 29 1 117 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 6.78e-05 45 29 1 117 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 6.78e-05 45 29 1 117 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P52936 6.82e-05 46 26 2 148 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q5FQQ0 7.54e-05 46 26 1 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Gluconobacter oxydans (strain 621H)
Q4ZYD3 7.91e-05 46 29 2 126 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
Q2IT50 7.98e-05 46 27 4 133 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain HaA2)
P26408 8.01e-05 46 33 4 116 1 hupR1 Hydrogenase transcriptional regulatory protein HupR1 Rhodobacter capsulatus
P32040 8.74e-05 45 27 6 177 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P42012 8.81e-05 45 25 1 116 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
Q4UU97 9.61e-05 45 27 1 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain 8004)
Q8P9J7 9.61e-05 45 27 1 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9HWA4 9.88e-05 45 25 5 195 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q20YL8 0.000101 45 26 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodopseudomonas palustris (strain BisB18)
Q0HIF6 0.000111 45 27 1 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-4)
Q01473 0.000121 45 26 2 123 3 rcaC Protein RcaC Microchaete diplosiphon
Q3SIG0 0.000123 45 24 1 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
P58357 0.000132 45 30 3 115 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
O87717 0.000132 45 32 0 68 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A0A4P7TS68 0.00014 45 27 2 116 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 0.00014 45 27 2 116 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 0.00014 45 27 2 116 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 0.00014 45 27 2 116 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 0.00014 45 27 2 116 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 0.00014 45 27 2 116 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 0.00014 45 27 2 116 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 0.00014 45 27 2 116 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q1D359 0.000141 45 29 2 117 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q311M8 0.000141 45 28 1 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P94413 0.000146 44 25 6 170 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P45709 0.000152 43 25 1 118 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
P52938 0.000156 45 30 1 105 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q4A010 0.000166 44 26 1 116 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P45337 0.000179 44 25 7 228 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8PX96 0.000181 45 24 5 178 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P18769 0.000184 45 30 3 117 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q9ZM64 0.000187 43 32 2 86 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P94514 0.000193 44 23 1 117 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
Q87S86 0.000209 44 26 2 120 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0A4H8 0.00021 44 25 1 118 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 0.00021 44 25 1 118 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q46PH7 0.000223 44 25 1 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2RZD2 0.00023 44 28 3 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
P71403 0.000237 42 32 2 86 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9I4N3 0.000247 44 30 1 102 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9CD68 0.000248 44 27 2 118 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
Q12YX1 0.000267 44 26 3 129 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q47I43 0.000279 44 29 0 67 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
Q0HVI0 0.000355 44 26 1 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-7)
P24072 0.000357 42 22 1 115 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q05522 0.000368 44 26 2 119 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
Q2LSL3 0.000371 43 30 1 93 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophus aciditrophicus (strain SB)
A0PWB4 0.000372 43 27 1 117 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q65JK6 0.000423 43 31 0 69 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8X738 0.000429 43 29 0 79 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P23836 0.000433 43 29 0 79 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q83RR0 0.00045 43 29 0 79 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 0.00045 43 29 0 79 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFU5 0.000462 43 30 0 81 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 0.000462 43 30 0 81 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q5L0L0 0.000476 43 26 1 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
Q15RF6 0.000495 43 27 1 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1KHB7 0.000522 43 26 2 141 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 0.000522 43 26 2 141 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1BRL2 0.00054 43 25 1 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q39KQ1 0.000584 43 25 1 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q99U73 0.000589 43 27 4 121 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q8Q009 0.000607 43 28 3 130 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P0C001 0.000635 42 27 4 121 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 0.000635 42 27 4 121 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 0.000635 42 27 4 121 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 0.000635 42 27 4 121 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 0.000635 42 27 4 121 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 0.000635 42 27 4 121 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 0.000635 42 27 4 121 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 0.000635 42 27 4 121 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q8TLG9 0.000684 43 29 3 125 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q7NSI8 0.000725 43 26 1 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5JF95 0.000728 43 30 2 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P13632 0.000741 43 31 4 118 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q8Z7H2 0.000752 42 24 1 127 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P42508 0.000763 42 31 0 64 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
P0DM78 0.000766 42 24 1 127 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 0.000766 42 24 1 127 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 0.000766 42 24 1 127 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 0.000766 42 24 1 127 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 0.000766 42 24 1 127 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P29267 0.000766 43 29 3 114 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q742C1 0.000789 42 26 2 141 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 0.000789 42 26 2 141 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P9WGM9 0.000804 42 26 2 141 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 0.000804 42 26 2 141 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 0.000804 42 26 2 141 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q2IQS6 0.001 43 27 4 148 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q3A5A8 0.001 42 26 1 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_14215
Feature type CDS
Gene citB
Product DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
Location 114851 - 115480 (strand: -1)
Length 630 (nucleotides) / 209 (amino acids)
In genomic island -

Contig

Accession ZDB_529
Length 159829 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1354
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00196 Bacterial regulatory proteins, luxR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4566 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, FixJ family, consists of REC and HTH domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K20264 two-component system, NarL family, response regulator FusR Two-component system
Quorum sensing
-

Protein Sequence

MIKIALIDDHVVVRSGFAQLLTLEPDITIAGQYASAAEAWPALTRPDIDVVIMDISMPDENGLQLLARLRERKTSFRTIILSIYDTPAFVQSALDAGASAYLTKRCGPEELVQAVRSVHQGGCYLCADAMRALRQSPPENRALEELTPREREVFDLLVAGMSVRAIADKLELSHKTVHVHRANVLGKLQCDSTIDLVHFALAHHLIAGQ

Flanking regions ( +/- flanking 50bp)

AACCTCTGTCAATAATTGATCCCTTTCTGCTGATAATACGCTGTCCGGACATGATAAAAATAGCGCTCATCGATGACCATGTAGTTGTGCGATCCGGTTTCGCCCAGCTCCTGACACTGGAGCCGGATATTACCATCGCCGGACAATATGCCAGTGCGGCGGAAGCCTGGCCCGCACTGACCCGTCCGGATATTGATGTGGTGATCATGGATATTTCCATGCCGGATGAAAACGGATTACAGCTGCTCGCCCGCCTGCGGGAGCGCAAAACCTCCTTCCGTACCATCATTCTCAGTATTTATGATACCCCTGCCTTTGTGCAGAGCGCGCTGGACGCCGGTGCCAGTGCGTATCTCACCAAACGCTGCGGCCCGGAAGAGCTGGTTCAGGCTGTGCGTTCCGTGCATCAGGGCGGCTGCTATCTGTGTGCGGATGCCATGCGTGCACTGCGCCAGTCACCGCCGGAAAACCGGGCGCTGGAAGAGCTGACCCCGCGTGAACGTGAGGTGTTTGATCTGCTGGTGGCCGGGATGAGTGTGCGGGCGATTGCGGATAAACTCGAACTCAGCCATAAAACCGTCCATGTCCACCGCGCCAATGTGCTGGGCAAACTGCAGTGTGACAGTACGATCGATCTGGTTCATTTTGCCCTGGCGCATCACCTTATCGCGGGGCAATAAGCCATGAGGCGCGGCGCTCGTCTGCTGTTACAGTCGGTATTTCTGCTGTT