Homologs in group_2747

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07620 FBDBKF_07620 100.0 Morganella morganii S1 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
EHELCC_13450 EHELCC_13450 100.0 Morganella morganii S2 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
LHKJJB_08955 LHKJJB_08955 100.0 Morganella morganii S3 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
HKOGLL_08505 HKOGLL_08505 100.0 Morganella morganii S5 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
F4V73_RS13500 F4V73_RS13500 97.3 Morganella psychrotolerans - BMC domain-containing protein

Distribution of the homologs in the orthogroup group_2747

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2747

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9XDM8 2.14e-76 229 57 0 184 1 pduT Bacterial microcompartment shell protein PduT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DUV7 3.86e-74 223 58 0 184 1 pduT Bacterial microcompartment shell protein PduT Citrobacter freundii
D0LHE3 7.65e-22 90 35 3 159 1 Hoch_5812 Bacterial microcompartment protein trimer-1 Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
D0LHE3 1.03e-05 47 38 3 92 1 Hoch_5812 Bacterial microcompartment protein trimer-1 Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
P0ABF4 1.86e-06 47 38 1 85 1 eutM Bacterial microcompartment shell protein EutM Escherichia coli (strain K12)
P0ABF5 1.86e-06 47 38 1 85 3 eutM Bacterial microcompartment shell protein EutM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P41791 3.01e-06 47 38 1 85 1 eutM Bacterial microcompartment shell protein EutM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23656 5.7e-06 48 28 4 175 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P46205 5.7e-06 48 28 4 175 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q55121 1.8e-05 47 36 2 83 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55121 9.21e-05 45 28 8 192 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A330 4.52e-05 43 34 3 90 2 csoS1 Carboxysome shell protein CsoS1 Synechococcus sp. (strain WH7803)
P0A328 4.52e-05 43 34 3 90 3 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P0A329 4.52e-05 43 34 3 90 1 csoS1 Carboxysome shell protein CsoS1 Parasynechococcus marenigrum (strain WH8102)
Q7V6F7 4.61e-05 43 34 3 90 1 csoS1 Carboxysome shell protein CsoS1 Prochlorococcus marinus (strain MIT 9313)
D0LID5 4.72e-05 43 38 1 80 1 Hoch_5815 Bacterial microcompartment protein homohexamer Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
Q7V2D1 5.26e-05 43 34 3 90 1 csoS1 Major carboxysome shell protein CsoS1 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P0DUM6 0.000173 42 36 2 92 1 pduA Bacterial microcompartment shell protein PduA Citrobacter freundii
P0A1C7 0.000175 42 36 2 92 1 pduA Bacterial microcompartment shell protein PduA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1C8 0.000175 42 36 2 92 3 pduA Bacterial microcompartment shell protein PduA Salmonella typhi
P72761 0.000226 42 30 2 90 1 ccmK2 Carboxysome shell protein CcmK2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P72761 0.000497 41 32 3 85 1 ccmK2 Carboxysome shell protein CcmK2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DKB3 0.000246 42 32 2 90 1 ccmK1 Carboxysome shell protein CcmK1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P72760 0.000308 42 30 2 90 1 ccmK1 Carboxysome shell protein CcmK1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7V6G4 0.000326 43 32 1 85 3 csoS1E Probable carboxysome shell protein CsoS1E Prochlorococcus marinus (strain MIT 9313)
O30709 0.000459 41 32 3 85 3 ccmK Carboxysome shell protein CcmK Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
O30709 0.001 40 31 2 90 3 ccmK Carboxysome shell protein CcmK Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P45690 0.000462 41 34 3 82 1 csoS1B Carboxysome shell protein CsoS1B Halothiobacillus neapolitanus (strain ATCC 23641 / c2)
Q8DKB2 0.001 40 30 2 90 1 ccmK2 Carboxysome shell protein CcmK2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_13895
Feature type CDS
Gene ccmK
Product Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
Location 30828 - 31382 (strand: 1)
Length 555 (nucleotides) / 184 (amino acids)

Contig

Accession ZDB_529
Length 159829 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2747
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00936 BMC domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4577 Secondary metabolites biosynthesis, transport and catabolism (Q)
Energy production and conversion (C)		 QC Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN

Protein Sequence

MHSAIAMVELSSIAKGMEVTDFMLKSAEVTLLMGKTVCPGKYVVMVGGDVAAAQQAMRCGVEKGGAQVVDEFLLSNIHPDVLPAIGGVTDVNAREAVGVVETFSVATCIEAADFAVKAAGVTLIRLHMAYGIGGKCYFVMSGDVADVETAKKAASQVAADKGALVYSMVVPNPHPDFWQQLVAG

Flanking regions ( +/- flanking 50bp)

GTGGTTCGCCATATTGACAGCTCGGCTGTCACGATAGAGAAGGAATAACTATGCACAGTGCAATTGCGATGGTGGAACTGTCCAGTATCGCCAAAGGGATGGAAGTCACCGATTTTATGCTCAAAAGTGCGGAAGTCACCCTGCTGATGGGCAAAACCGTGTGTCCCGGCAAATATGTGGTGATGGTCGGCGGTGATGTTGCCGCCGCACAGCAGGCAATGCGCTGCGGTGTGGAAAAAGGCGGTGCTCAGGTAGTGGATGAGTTTCTGCTCAGTAATATCCACCCGGATGTGCTCCCGGCTATCGGTGGTGTGACGGATGTGAATGCCCGCGAAGCCGTCGGGGTAGTGGAAACCTTTAGTGTCGCAACCTGCATTGAGGCGGCGGATTTTGCTGTTAAAGCAGCCGGCGTCACGTTAATACGACTTCATATGGCGTATGGTATCGGGGGTAAATGTTACTTTGTGATGAGCGGCGATGTTGCAGACGTCGAAACCGCCAAAAAAGCCGCATCACAGGTCGCCGCAGATAAAGGTGCGCTGGTTTACAGCATGGTCGTACCGAATCCTCATCCCGATTTCTGGCAGCAATTGGTCGCTGGTTAACATTTATGGCGGCCGTTCATTTTGGGGAAAAAATAATGATGAAAAAAATC