Homologs in group_2771

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07620 FBDBKF_07620 97.3 Morganella morganii S1 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
EHELCC_13450 EHELCC_13450 97.3 Morganella morganii S2 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
NLDBIP_13895 NLDBIP_13895 97.3 Morganella morganii S4 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
LHKJJB_08955 LHKJJB_08955 97.3 Morganella morganii S3 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN
HKOGLL_08505 HKOGLL_08505 97.3 Morganella morganii S5 ccmK Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN

Distribution of the homologs in the orthogroup group_2771

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2771

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9XDM8 6.34e-77 231 57 0 184 1 pduT Bacterial microcompartment shell protein PduT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DUV7 1.64e-74 224 58 0 184 1 pduT Bacterial microcompartment shell protein PduT Citrobacter freundii
D0LHE3 2.19e-22 92 36 3 159 1 Hoch_5812 Bacterial microcompartment protein trimer-1 Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
D0LHE3 2.36e-05 46 36 3 90 1 Hoch_5812 Bacterial microcompartment protein trimer-1 Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
P0ABF4 1.27e-06 48 38 1 85 1 eutM Bacterial microcompartment shell protein EutM Escherichia coli (strain K12)
P0ABF5 1.27e-06 48 38 1 85 3 eutM Bacterial microcompartment shell protein EutM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P41791 2.1e-06 47 38 1 85 1 eutM Bacterial microcompartment shell protein EutM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23656 2.41e-06 49 28 4 175 3 ccmO Carboxysome assembly protein CcmO Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P46205 2.41e-06 49 28 4 175 1 ccmO Carboxysome assembly protein CcmO Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q55121 1.29e-05 47 36 2 83 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55121 0.00051 43 27 7 188 3 ccmO Carboxysome assembly protein CcmO Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
D0LID5 2.46e-05 44 38 1 80 1 Hoch_5815 Bacterial microcompartment protein homohexamer Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
P0A1C7 0.000117 42 36 2 92 1 pduA Bacterial microcompartment shell protein PduA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1C8 0.000117 42 36 2 92 3 pduA Bacterial microcompartment shell protein PduA Salmonella typhi
P0DUM6 0.000124 42 36 2 92 1 pduA Bacterial microcompartment shell protein PduA Citrobacter freundii
O30709 0.00017 42 34 3 85 3 ccmK Carboxysome shell protein CcmK Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P72761 0.000233 42 32 3 85 1 ccmK2 Carboxysome shell protein CcmK2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P72761 0.00083 40 28 2 90 1 ccmK2 Carboxysome shell protein CcmK2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q187N0 0.000672 40 40 2 80 1 eutM Bacterial microcompartment shell protein EutM Clostridioides difficile (strain 630)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13500
Feature type CDS
Gene -
Product BMC domain-containing protein
Location 334449 - 335003 (strand: -1)
Length 555 (nucleotides) / 184 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2771
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00936 BMC domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4577 Secondary metabolites biosynthesis, transport and catabolism (Q)
Energy production and conversion (C)		 QC Carboxysome shell and ethanolamine utilization microcompartment protein CcmL/EutN

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K27272 bacterial microcompartment shell protein - -

Protein Sequence

MHSAIAMVELSSIAKGMEVTDFMLKSADVKLLMGKTVCPGKYVVMVGGDVAAAQQAMQCGVEKGGAQVVDEFLLSNIHPDVLPAIGGVTEVNAREAVGVVETFSVATCIEAADFAVKAAGVTLIRLHMAYGIGGKCYFVMSGDVADVETAKKAASQVASDKGALVYSMVVPNPHPDFWQQLVAG

Flanking regions ( +/- flanking 50bp)

GTAGTCCGCCATATTGACAGCACCGCTGTCACGATAGAGAGAGAATAAATATGCACAGCGCAATTGCGATGGTTGAGCTTTCCAGCATCGCCAAAGGCATGGAAGTGACAGACTTTATGCTGAAAAGTGCCGATGTAAAATTGCTGATGGGCAAAACAGTCTGCCCCGGCAAATATGTTGTCATGGTCGGCGGTGATGTGGCAGCCGCGCAGCAGGCGATGCAGTGCGGTGTTGAAAAAGGTGGCGCACAGGTAGTGGATGAATTTTTGCTCAGCAATATCCATCCTGACGTTCTGCCCGCTATCGGCGGTGTGACAGAGGTAAATGCCCGCGAAGCCGTGGGAGTAGTGGAAACCTTTAGTGTTGCGACCTGCATTGAAGCGGCAGATTTTGCTGTTAAAGCAGCCGGCGTCACGTTAATACGTCTTCACATGGCGTATGGTATTGGCGGTAAGTGTTACTTTGTGATGAGCGGCGATGTGGCAGATGTCGAAACCGCGAAAAAAGCGGCATCACAGGTAGCTTCTGATAAAGGTGCGCTGGTCTACAGCATGGTCGTACCTAACCCTCATCCCGATTTCTGGCAGCAACTGGTCGCAGGTTAATATGATGACGGCCGTTCATTTTGGGGACAAACTGATGAAGAAAATCACGC