Homologs in group_3447

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14975 FBDBKF_14975 100.0 Morganella morganii S1 - Prophage CPS-53 integrase
EHELCC_11270 EHELCC_11270 100.0 Morganella morganii S2 - Prophage CPS-53 integrase
LHKJJB_11475 LHKJJB_11475 100.0 Morganella morganii S3 - Prophage CPS-53 integrase
HKOGLL_10085 HKOGLL_10085 100.0 Morganella morganii S5 - Prophage CPS-53 integrase

Distribution of the homologs in the orthogroup group_3447

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3447

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76542 1.36e-23 95 51 1 89 3 intZ Prophage integrase IntZ Escherichia coli (strain K12)
P39347 2.91e-23 94 61 0 65 5 intB Putative protein IntB Escherichia coli (strain K12)
P37326 1.14e-20 87 48 0 84 1 intS Prophage integrase IntS Escherichia coli (strain K12)
P37317 1.27e-20 87 48 0 84 3 int Integrase Shigella phage Sf6
P08320 9.5e-18 79 44 1 83 3 int Integrase Enterobacteria phage P4
P32053 1.45e-13 67 41 2 86 1 intA Prophage integrase IntA Escherichia coli (strain K12)
P06155 2.53e-07 49 32 1 89 3 int Integrase Enterobacteria phage phi80

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_11615
Feature type CDS
Gene -
Product Prophage CPS-53 integrase
Location 76033 - 76305 (strand: 1)
Length 273 (nucleotides) / 90 (amino acids)
In genomic island GI10

Contig

Accession ZDB_526
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3447
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF13356 Arm DNA-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0582 Replication, recombination and repair (L)
Mobilome: prophages, transposons (X)
LX Integrase/recombinase, includes phage integrase

Protein Sequence

MALTDAKIRAAKPQEKPYKLADSGNMFLLVHPNGSRYWRLRYRFQGKEKTSALGIYPELSLSDARDKRDSARKQIAEGIDPCEQKRIKKV

Flanking regions ( +/- flanking 50bp)

GCCTGATTCGACAGGAATTTGTACCCTCTCGTCTTCCGGAGACCCCTTTTATGGCACTTACTGACGCTAAGATTCGGGCTGCAAAACCGCAAGAAAAACCCTATAAACTTGCTGATTCCGGCAACATGTTTTTACTTGTTCATCCCAACGGCTCACGTTACTGGCGACTCCGTTACCGCTTTCAGGGAAAAGAAAAAACATCGGCTCTGGGAATTTATCCTGAATTATCCCTTTCTGACGCACGTGATAAAAGAGACAGCGCACGTAAGCAGATTGCTGAGGGTATCGACCCTTGTGAACAGAAACGGATAAAGAAAGTGTAAGTATCCCGGAAAAACGAACCATTAACTTTAACAGATATGTCGATTTCAGC